# Service API API for application services ## Version: 1.0 ### Available authorizations #### Bearer (HTTP, bearer) Use the Service API key as a Bearer token in the Authorization header. Bearer format: API_KEY --- ## service_api Service operations ### [GET] / #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Success | **application/json**: [IndexInfoResponse](#indexinforesponse)
| ### ~~[POST] /datasets/{dataset_id}/document/create_by_text~~ ***DEPRECATED*** Deprecated legacy alias for creating a new document by providing text content. Use /datasets/{dataset_id}/document/create-by-text instead. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [DocumentTextCreatePayload](#documenttextcreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document created successfully | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)
| | 400 | Bad request - invalid parameters | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | ### ~~[POST] /datasets/{dataset_id}/documents/{document_id}/update_by_text~~ ***DEPRECATED*** Deprecated legacy alias for updating an existing document by providing text content. Use /datasets/{dataset_id}/documents/{document_id}/update-by-text instead. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [DocumentTextUpdate](#documenttextupdate)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document updated successfully | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Document not found | | ### [POST] /knowledge-fs/query-stream #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSAdmittedQueryRequest](#knowledgefsadmittedqueryrequest)
| #### Responses | Code | Description | | ---- | ----------- | | 200 | KnowledgeFS query event stream | ### [GET] /knowledge-fs/spaces/{control_space_id}/bulk-jobs/{job_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | job_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS bulk job | **application/json**: [KnowledgeFSBulkJobResponse](#knowledgefsbulkjobresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/documents #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | cursor | query | | No | string | | control_space_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS documents | **application/json**: [KnowledgeFSDocumentListResponse](#knowledgefsdocumentlistresponse)
| ### ~~[POST] /knowledge-fs/spaces/{control_space_id}/documents~~ ***DEPRECATED*** #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSDocumentCreatePayload](#knowledgefsdocumentcreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 201 | KnowledgeFS document created | **application/json**: [KnowledgeFSDocumentResponse](#knowledgefsdocumentresponse)
| ### [DELETE] /knowledge-fs/spaces/{control_space_id}/documents/bulk #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSBulkDocumentDeletePayload](#knowledgefsbulkdocumentdeletepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 202 | KnowledgeFS document deletions accepted | **application/json**: [KnowledgeFSBulkDeletionAcceptedResponse](#knowledgefsbulkdeletionacceptedresponse)
| ### [POST] /knowledge-fs/spaces/{control_space_id}/documents/reindex #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSDocumentReindexPayload](#knowledgefsdocumentreindexpayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS document reindex queued | **application/json**: [KnowledgeFSDocumentReindexResponse](#knowledgefsdocumentreindexresponse)
| ### [DELETE] /knowledge-fs/spaces/{control_space_id}/documents/{document_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | document_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSDocumentDeletePayload](#knowledgefsdocumentdeletepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 202 | KnowledgeFS document deletion accepted | **application/json**: [KnowledgeFSDurableDeletionAcceptedResponse](#knowledgefsdurabledeletionacceptedresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | document_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS document | **application/json**: [KnowledgeFSDocumentResponse](#knowledgefsdocumentresponse)
| ### [PATCH] /knowledge-fs/spaces/{control_space_id}/documents/{document_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | document_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSDocumentMetadataPayload](#knowledgefsdocumentmetadatapayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS document metadata updated | **application/json**: [KnowledgeFSLogicalDocumentResponse](#knowledgefslogicaldocumentresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/outline #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | document_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS document outline | **application/json**: [KnowledgeFSDocumentOutlineResponse](#knowledgefsdocumentoutlineresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/revisions #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | cursor | query | | No | string | | control_space_id | path | | Yes | string | | document_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS document revisions | **application/json**: [KnowledgeFSDocumentRevisionListResponse](#knowledgefsdocumentrevisionlistresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/revisions/{revision}/chunks #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | cursor | query | | No | string | | query | query | | No | string | | control_space_id | path | | Yes | string | | document_id | path | | Yes | string | | revision | path | | Yes | integer | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS document chunks | **application/json**: [KnowledgeFSDocumentChunkListResponse](#knowledgefsdocumentchunklistresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/revisions/{revision}/chunks/{chunk_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | chunk_id | path | | Yes | string | | control_space_id | path | | Yes | string | | document_id | path | | Yes | string | | revision | path | | Yes | integer | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS document chunk | **application/json**: [KnowledgeFSDocumentChunkResponse](#knowledgefsdocumentchunkresponse)
| ### [DELETE] /knowledge-fs/spaces/{control_space_id}/jobs/{job_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | job_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS compilation job canceled | **application/json**: [KnowledgeFSDocumentCompilationJobResponse](#knowledgefsdocumentcompilationjobresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/jobs/{job_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | job_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS compilation job | **application/json**: [KnowledgeFSDocumentCompilationJobResponse](#knowledgefsdocumentcompilationjobresponse)
| ### [POST] /knowledge-fs/spaces/{control_space_id}/jobs/{job_id}/retry #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | job_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS compilation job retried | **application/json**: [KnowledgeFSDocumentCompilationJobResponse](#knowledgefsdocumentcompilationjobresponse)
| ### ~~[POST] /knowledge-fs/spaces/{control_space_id}/queries~~ ***DEPRECATED*** #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSQueryCreatePayload](#knowledgefsquerycreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 202 | KnowledgeFS query accepted | **application/json**: [KnowledgeFSQueryResponse](#knowledgefsqueryresponse)
| ### [POST] /knowledge-fs/spaces/{control_space_id}/queries/admission #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSQueryCreatePayload](#knowledgefsquerycreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS streaming query admitted through Dify API | **application/json**: [KnowledgeFSQueryAdmissionResponse](#knowledgefsqueryadmissionresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/research-tasks #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | cursor | query | | No | string | | control_space_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS research tasks | **application/json**: [KnowledgeFSResearchTaskListResponse](#knowledgefsresearchtasklistresponse)
| ### [POST] /knowledge-fs/spaces/{control_space_id}/research-tasks #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSResearchTaskCreatePayload](#knowledgefsresearchtaskcreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 202 | KnowledgeFS research task accepted | **application/json**: [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse)
| ### [POST] /knowledge-fs/spaces/{control_space_id}/research-tasks/plan #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSResearchTaskPlanPayload](#knowledgefsresearchtaskplanpayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS research task plan | **application/json**: [KnowledgeFSResearchTaskPlanResponse](#knowledgefsresearchtaskplanresponse)
| ### [DELETE] /knowledge-fs/spaces/{control_space_id}/research-tasks/{task_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | task_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS research task canceled | **application/json**: [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/research-tasks/{task_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | task_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS research task | **application/json**: [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/research-tasks/{task_id}/partials #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | cursor | query | | No | string | | limit | query | | No | integer,
**Default:** 25 | | control_space_id | path | | Yes | string | | task_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS research task partial evidence | **application/json**: [KnowledgeFSResearchTaskPartialListResponse](#knowledgefsresearchtaskpartiallistresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/settings #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS settings | **application/json**: [KnowledgeFSSettingsResponse](#knowledgefssettingsresponse)
| ### [PATCH] /knowledge-fs/spaces/{control_space_id}/settings #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSSettingsPayload](#knowledgefssettingspayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS settings updated | **application/json**: [KnowledgeFSSettingsResponse](#knowledgefssettingsresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/sources #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | cursor | query | | No | string | | control_space_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS sources | **application/json**: [KnowledgeFSSourceListResponse](#knowledgefssourcelistresponse)
| ### [POST] /knowledge-fs/spaces/{control_space_id}/sources #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSSourceCreatePayload](#knowledgefssourcecreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 201 | KnowledgeFS source created | **application/json**: [KnowledgeFSSourceResponse](#knowledgefssourceresponse)
| ### [DELETE] /knowledge-fs/spaces/{control_space_id}/sources/{source_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | documents | query | | No | string,
**Available values:** "cascade", "keep",
**Default:** cascade | | control_space_id | path | | Yes | string | | source_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSSourceDeletePayload](#knowledgefssourcedeletepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 202 | KnowledgeFS source deletion accepted | **application/json**: [KnowledgeFSDurableDeletionAcceptedResponse](#knowledgefsdurabledeletionacceptedresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/sources/{source_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | source_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS source | **application/json**: [KnowledgeFSSourceResponse](#knowledgefssourceresponse)
| ### [PATCH] /knowledge-fs/spaces/{control_space_id}/sources/{source_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | source_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSSourceUpdatePayload](#knowledgefssourceupdatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS source updated | **application/json**: [KnowledgeFSSourceResponse](#knowledgefssourceresponse)
| ### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/crawl #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | source_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS source crawl | **application/json**: [KnowledgeFSSourceCrawlResponse](#knowledgefssourcecrawlresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/files #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | bucket | query | | No | string | | continuationToken | query | | No | string | | maxKeys | query | | No | integer | | prefix | query | | No | string | | control_space_id | path | | Yes | string | | source_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS source files | **application/json**: [KnowledgeFSSourceFilesResponse](#knowledgefssourcefilesresponse)
| ### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/import #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | source_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSSourceImportPagesPayload](#knowledgefssourceimportpagespayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS source pages imported | **application/json**: [KnowledgeFSSourceImportResponse](#knowledgefssourceimportresponse)
| ### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/import-files #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | source_id | path | | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [KnowledgeFSSourceImportFilesPayload](#knowledgefssourceimportfilespayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS source files imported | **application/json**: [KnowledgeFSSourceImportResponse](#knowledgefssourceimportresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/pages #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | cursor | query | | No | string | | limit | query | | No | integer,
**Default:** 50 | | control_space_id | path | | Yes | string | | source_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS source pages | **application/json**: [KnowledgeFSSourcePagesResponse](#knowledgefssourcepagesresponse)
| ### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/test #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | source_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS source credential test | **application/json**: [KnowledgeFSSourceCredentialTestResponse](#knowledgefssourcecredentialtestresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/traces #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | cursor | query | | No | string | | control_space_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS traces | **application/json**: [KnowledgeFSTraceListResponse](#knowledgefstracelistresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id} #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | control_space_id | path | | Yes | string | | trace_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS answer trace | **application/json**: [KnowledgeFSAnswerTraceResponse](#knowledgefsanswertraceresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id}/conflicts #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | cursor | query | | No | string | | limit | query | | No | integer,
**Default:** 100 | | control_space_id | path | | Yes | string | | trace_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS trace conflicts | **application/json**: [KnowledgeFSTraceEntryListResponse](#knowledgefstraceentrylistresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id}/evidence #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | cursor | query | | No | string | | limit | query | | No | integer,
**Default:** 100 | | control_space_id | path | | Yes | string | | trace_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS trace evidence view | **application/json**: [KnowledgeFSTraceEntryListResponse](#knowledgefstraceentrylistresponse)
| ### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id}/missing #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | cursor | query | | No | string | | limit | query | | No | integer,
**Default:** 100 | | control_space_id | path | | Yes | string | | trace_id | path | | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | KnowledgeFS trace missing evidence | **application/json**: [KnowledgeFSTraceEntryListResponse](#knowledgefstraceentrylistresponse)
| --- ## default ### [GET] /app/feedbacks **List App Feedbacks** Retrieve a paginated list of all feedback submitted for messages in this application, including both end-user and admin feedback. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | limit | query | Number of records per page. | No | integer,
**Default:** 20 | | page | query | Page number for pagination. | No | integer,
**Default:** 1 | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | A list of application feedbacks. | **application/json**: [AppFeedbackListResponse](#appfeedbacklistresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | ### [POST] /messages/{message_id}/feedbacks **Submit Message Feedback** Submit feedback for a message. End users can rate messages as `like` or `dislike`, and optionally provide text feedback. Pass `null` for `rating` to revoke previously submitted feedback. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | message_id | path | Message ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [MessageFeedbackPayloadWithUser](#messagefeedbackpayloadwithuser)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Feedback submitted successfully | **application/json**: [ResultResponse](#resultresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Message does not exist. | | --- ## default ### [POST] /apps/annotation-reply/{action} **Configure Annotation Reply** Enables or disables the annotation reply feature. Requires embedding model configuration when enabling. Executes asynchronously — use [Get Annotation Reply Job Status](/api-reference/annotations/get-annotation-reply-job-status) to track progress. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | action | path | Action to perform: `enable` or `disable`. | Yes | string,
**Available values:** "disable", "enable" | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [AnnotationReplyActionPayload](#annotationreplyactionpayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Annotation reply settings task initiated. | **application/json**: [AnnotationJobStatusResponse](#annotationjobstatusresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | ### [GET] /apps/annotation-reply/{action}/status/{job_id} **Get Annotation Reply Job Status** Retrieves the status of an asynchronous annotation reply configuration job started by [Configure Annotation Reply](/api-reference/annotations/configure-annotation-reply). #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | action | path | Action to perform: `enable` or `disable`. | Yes | string,
**Available values:** "disable", "enable" | | job_id | path | Job ID returned by [Configure Annotation Reply](/api-reference/annotations/configure-annotation-reply). | Yes | string (uuid) | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successfully retrieved task status. | **application/json**: [AnnotationJobStatusDetailResponse](#annotationjobstatusdetailresponse)
| | 400 | `invalid_param` : The specified job does not exist. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | Job not found | | ### [GET] /apps/annotations **List Annotations** Retrieves a paginated list of annotations for the application. Supports keyword search filtering. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | keyword | query | Keyword to filter annotations by question or answer content. | No | string | | limit | query | Number of items per page. | No | integer,
**Default:** 20 | | page | query | Page number for pagination. | No | integer,
**Default:** 1 | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successfully retrieved annotation list. | **application/json**: [AnnotationList](#annotationlist)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | ### [POST] /apps/annotations **Create Annotation** Creates a new annotation. Annotations provide predefined question-answer pairs that the app can match and return directly instead of generating a response. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [AnnotationCreatePayload](#annotationcreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 201 | Annotation created successfully. | **application/json**: [Annotation](#annotation)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | ### [DELETE] /apps/annotations/{annotation_id} **Delete Annotation** Deletes an annotation and its associated hit history. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | annotation_id | path | The unique identifier of the annotation to delete. | Yes | string (uuid) | #### Responses | Code | Description | | ---- | ----------- | | 204 | Annotation deleted successfully. | | 401 | Unauthorized - invalid API token | | 403 | `forbidden` : Insufficient permissions to edit annotations. | | 404 | `not_found` : Annotation does not exist. | ### [PUT] /apps/annotations/{annotation_id} **Update Annotation** Updates the question and answer of an existing annotation. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | annotation_id | path | The unique identifier of the annotation to update. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [AnnotationCreatePayload](#annotationcreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Annotation updated successfully. | **application/json**: [Annotation](#annotation)
| | 401 | Unauthorized - invalid API token | | | 403 | `forbidden` : Insufficient permissions to edit annotations. | | | 404 | `not_found` : Annotation does not exist. | | --- ## default ### [POST] /audio-to-text **Convert Audio to Text** Convert audio file to text. Supported MIME types: `audio/mp3`, `audio/mpga`, `audio/m4a`, `audio/x-m4a`, `audio/wav`, and `audio/amr`. File size limit is `30 MB`. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **multipart/form-data**: { **"file"**: binary, **"user"**: string }
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successfully converted audio to text. | **application/json**: [AudioTranscriptResponse](#audiotranscriptresponse)
| | 400 | - `app_unavailable` : App unavailable or misconfigured. - `speech_to_text_disabled` : Speech-to-text is disabled for this app. - `provider_not_support_speech_to_text` : Model provider does not support speech-to-text. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model does not support this operation. - `completion_request_error` : Speech recognition request failed. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 413 | `audio_too_large` : Audio file size exceeded the limit. | | | 415 | `unsupported_audio_type` : Audio type is not allowed. | | | 500 | `internal_server_error` : Internal server error. | | ### [POST] /text-to-audio **Convert Text to Audio** Convert text to speech. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [TextToAudioPayloadWithUser](#texttoaudiopayloadwithuser)
| #### Responses | Code | Description | | ---- | ----------- | | 200 | Returns the generated audio. Generator responses are streamed by the service as `audio/mpeg`; otherwise the provider output is returned directly. | | 400 | - `app_unavailable` : App unavailable or misconfigured. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model does not support this operation. - `completion_request_error` : Text-to-speech request failed. | | 401 | Unauthorized - invalid API token | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | 500 | `internal_server_error` : Internal server error. | --- ## default ### [POST] /chat-messages **Send Chat Message** Send a request to the chat application. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [ChatRequestPayloadWithUser](#chatrequestpayloadwithuser)
| #### Responses | Code | Description | | ---- | ----------- | | 200 | Successful response. The content type and structure depend on the `response_mode` parameter in the request. - If `response_mode` is `blocking`, returns `application/json` with a `ChatCompletionResponse` object. - If `response_mode` is `streaming`, returns `text/event-stream` with a stream of Server-Sent Events. | | 400 | - `app_unavailable` : App unavailable or misconfigured. - `not_chat_app` : App mode does not match the API route. - `conversation_completed` : The conversation has ended. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model unavailable. - `completion_request_error` : Text generation failed. | | 401 | Unauthorized - invalid API token | | 403 | `workflow_version_execution_not_allowed` : Workflow version execution is unavailable on the current plan. Upgrade to a paid plan. | | 404 | `not_found` : Conversation does not exist. | | 429 | - `too_many_requests` : Too many concurrent requests for this app. - `rate_limit_error` : The upstream model provider rate limit was exceeded. | | 500 | `internal_server_error` : Internal server error. | ### [POST] /chat-messages/{task_id}/stop **Stop Chat Message Generation** Stops a chat message generation task. Only supported in `streaming` mode. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | task_id | path | Task ID, obtained from a streaming chunk returned by the Send Chat Message API. | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [RequiredServiceApiUserPayload](#requiredserviceapiuserpayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)
| | 400 | `not_chat_app` : App mode does not match the API route. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | Task not found | | ### [GET] /messages/{message_id}/suggested **Get Next Suggested Questions** Get next questions suggestions for the current message. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | message_id | path | Message ID | Yes | string (uuid) | | user | query | User identifier, used for end-user context. | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Suggested questions retrieved successfully | **application/json**: [SimpleResultStringListResponse](#simpleresultstringlistresponse)
| | 400 | - `not_chat_app` : App mode does not match the API route. - `bad_request` : Suggested questions feature is disabled. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Message does not exist. | | | 500 | `internal_server_error` : Internal server error. | | ### [GET] /workflow/{task_id}/events **Stream Workflow Events** Resume the Server-Sent Events stream for a workflow run after a pause or a dropped SSE connection. For runs that have already finished, the stream emits a single `workflow_finished` event and closes. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | task_id | path | Workflow run ID returned by the original workflow run request. | Yes | string | | continue_on_pause | query | Set to `true` to keep the stream open across multiple `workflow_paused` events, which is useful when the workflow has more than one Human Input node in sequence. By default, the stream closes after the first pause. | No | boolean | | include_state_snapshot | query | When `true`, replay from the persisted state snapshot to include a status summary of already-executed nodes before streaming new events. | No | boolean | | user | query | End-user identifier that originally triggered the run. Must match the creator of the run. | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Server-Sent Events stream. Each event is delivered as `data: {JSON}\\n\\n`. Event payloads follow the same schemas as the original streaming response. | **text/event-stream**: [EventStreamResponse](#eventstreamresponse)
| | 400 | `not_workflow_app` : Please check if your app mode matches the right API route. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Workflow run not found. | | ### [GET] /workflows/logs **List Workflow Logs** Retrieve paginated workflow execution logs with filtering options. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | created_at__after | query | Filter logs created after this ISO 8601 timestamp. | No | dateTime | | created_at__before | query | Filter logs created before this ISO 8601 timestamp. | No | dateTime | | created_by_account | query | Filter by account ID. | No | string | | created_by_end_user_session_id | query | Filter by end user session ID. | No | string | | keyword | query | Keyword to search in logs. | No | string | | limit | query | Number of items per page. | No | integer,
**Default:** 20 | | page | query | Page number for pagination. | No | integer,
**Default:** 1 | | status | query | Filter by execution status. | No | string,
**Available values:** "failed", "stopped", "succeeded" | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successfully retrieved workflow logs. | **application/json**: [WorkflowAppLogPaginationResponse](#workflowapplogpaginationresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | ### [GET] /workflows/run/{workflow_run_id} **Get Workflow Run Detail** Retrieve the current execution results of a workflow task based on the workflow execution ID. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | workflow_run_id | path | Workflow run ID, obtained from the workflow execution response or streaming events. | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successfully retrieved workflow run details. | **application/json**: [WorkflowRunResponse](#workflowrunresponse)
| | 400 | `not_workflow_app` : App mode does not match the API route. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Workflow run not found. | | --- ## default ### [POST] /chat-messages **Send Chat Message** Send a request to the chat application. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [ChatRequestPayloadWithUser](#chatrequestpayloadwithuser)
| #### Responses | Code | Description | | ---- | ----------- | | 200 | Successful response. The content type and structure depend on the `response_mode` parameter in the request. - If `response_mode` is `blocking`, returns `application/json` with a `ChatCompletionResponse` object. - If `response_mode` is `streaming`, returns `text/event-stream` with a stream of Server-Sent Events. | | 400 | - `app_unavailable` : App unavailable or misconfigured. - `not_chat_app` : App mode does not match the API route. - `conversation_completed` : The conversation has ended. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model unavailable. - `completion_request_error` : Text generation failed. | | 401 | Unauthorized - invalid API token | | 403 | `workflow_version_execution_not_allowed` : Workflow version execution is unavailable on the current plan. Upgrade to a paid plan. | | 404 | `not_found` : Conversation does not exist. | | 429 | - `too_many_requests` : Too many concurrent requests for this app. - `rate_limit_error` : The upstream model provider rate limit was exceeded. | | 500 | `internal_server_error` : Internal server error. | ### [POST] /chat-messages/{task_id}/stop **Stop Chat Message Generation** Stops a chat message generation task. Only supported in `streaming` mode. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | task_id | path | Task ID, obtained from a streaming chunk returned by the Send Chat Message API. | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [RequiredServiceApiUserPayload](#requiredserviceapiuserpayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)
| | 400 | `not_chat_app` : App mode does not match the API route. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | Task not found | | ### [GET] /messages/{message_id}/suggested **Get Next Suggested Questions** Get next questions suggestions for the current message. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | message_id | path | Message ID | Yes | string (uuid) | | user | query | User identifier, used for end-user context. | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Suggested questions retrieved successfully | **application/json**: [SimpleResultStringListResponse](#simpleresultstringlistresponse)
| | 400 | - `not_chat_app` : App mode does not match the API route. - `bad_request` : Suggested questions feature is disabled. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Message does not exist. | | | 500 | `internal_server_error` : Internal server error. | | --- ## default ### [POST] /completion-messages **Send Completion Message** Send a request to the text generation application. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [CompletionRequestPayloadWithUser](#completionrequestpayloadwithuser)
| #### Responses | Code | Description | | ---- | ----------- | | 200 | Successful response. The content type and structure depend on the `response_mode` parameter in the request. - If `response_mode` is `blocking`, returns `application/json` with a `CompletionResponse` object. - If `response_mode` is `streaming`, returns `text/event-stream` with a stream of `ChunkCompletionEvent` objects. | | 400 | - `app_unavailable` : App unavailable or misconfigured. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model unavailable. - `completion_request_error` : Text generation failed. | | 401 | Unauthorized - invalid API token | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | 404 | Conversation not found | | 429 | `too_many_requests` : Too many concurrent requests for this app. | | 500 | `internal_server_error` : Internal server error. | ### [POST] /completion-messages/{task_id}/stop **Stop Completion Message Generation** Stops a completion message generation task. Only supported in `streaming` mode. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | task_id | path | Task ID, obtained from a streaming chunk returned by the Send Completion Message API. | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [RequiredServiceApiUserPayload](#requiredserviceapiuserpayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)
| | 400 | `app_unavailable` : App unavailable or misconfigured. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | Task not found | | --- ## default ### [GET] /conversations **List Conversations** Retrieve the conversation list for the current user, ordered by most recently active. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | last_id | query | The ID of the last record on the current page. Used to fetch the next page. | No | string | | limit | query | Number of records to return. | No | integer,
**Default:** 20 | | sort_by | query | Sorting field. Use the `-` prefix for descending order. | No | string,
**Available values:** "-created_at", "-updated_at", "created_at", "updated_at",
**Default:** -updated_at | | user | query | User identifier, used for end-user context. | No | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successfully retrieved conversations list. | **application/json**: [ConversationInfiniteScrollPagination](#conversationinfinitescrollpagination)
| | 400 | `not_chat_app` : App mode does not match the API route. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Last conversation does not exist (invalid `last_id`). | | ### [DELETE] /conversations/{c_id} **Delete Conversation** Delete a conversation. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | c_id | path | Conversation ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [OptionalServiceApiUserPayload](#optionalserviceapiuserpayload)
| #### Responses | Code | Description | | ---- | ----------- | | 204 | Conversation deleted successfully. | | 400 | `not_chat_app` : App mode does not match the API route. | | 401 | Unauthorized - invalid API token | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | 404 | `not_found` : Conversation does not exist. | ### [POST] /conversations/{c_id}/name **Rename Conversation** Rename a conversation or auto-generate a name. The conversation name is used for display on clients that support multiple conversations. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | c_id | path | Conversation ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [ConversationRenamePayloadWithUser](#conversationrenamepayloadwithuser)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Conversation renamed successfully. | **application/json**: [SimpleConversation](#simpleconversation)
| | 400 | `not_chat_app` : App mode does not match the API route. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Conversation does not exist. | | ### [GET] /conversations/{c_id}/variables **List Conversation Variables** Retrieve variables from a specific conversation. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | c_id | path | Conversation ID. | Yes | string (uuid) | | last_id | query | The ID of the last record on the current page. Used to fetch the next page. | No | string | | limit | query | Number of records to return. | No | integer,
**Default:** 20 | | user | query | User identifier, used for end-user context. | No | string | | variable_name | query | Filter variables by a specific name. | No | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successfully retrieved conversation variables. | **application/json**: [ConversationVariableInfiniteScrollPaginationResponse](#conversationvariableinfinitescrollpaginationresponse)
| | 400 | `not_chat_app` : App mode does not match the API route. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Conversation does not exist. | | ### [PUT] /conversations/{c_id}/variables/{variable_id} **Update Conversation Variable** Update the value of a specific conversation variable. The value must match the expected type. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | c_id | path | Conversation ID. | Yes | string (uuid) | | variable_id | path | Variable ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [ConversationVariableUpdatePayloadWithUser](#conversationvariableupdatepayloadwithuser)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Variable updated successfully. | **application/json**: [ConversationVariableResponse](#conversationvariableresponse)
| | 400 | - `not_chat_app` : App mode does not match the API route. - `bad_request` : Variable value type mismatch. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | - `not_found` : Conversation does not exist. - `not_found` : Conversation variable does not exist. | | ### [GET] /messages **List Conversation Messages** Returns historical chat records in a scrolling load format, with the first page returning the latest `limit` messages, i.e., in reverse order. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | conversation_id | query | Conversation ID. | Yes | string | | first_id | query | The ID of the first chat record on the current page. Omit this value to fetch the latest messages; for subsequent pages, use the first message ID from the current list to fetch older messages. | No | string | | limit | query | Number of chat history messages to return per request. | No | integer,
**Default:** 20 | | user | query | User identifier, used for end-user context. | No | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successfully retrieved conversation history. | **application/json**: [MessageInfiniteScrollPagination](#messageinfinitescrollpagination)
| | 400 | `not_chat_app` : App mode does not match the API route. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | - `not_found` : Conversation does not exist. - `not_found` : First message does not exist. | | --- ## default ### [GET] /datasets **List Knowledge Bases** Returns a paginated list of knowledge bases. Supports filtering by keyword and tags. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | include_all | query | Whether to include all knowledge bases regardless of permissions. | No | boolean | | keyword | query | Search keyword to filter by name. | No | string | | limit | query | Number of items per page. Server caps at `100`. | No | integer,
**Default:** 20 | | page | query | Page number to retrieve. | No | integer,
**Default:** 1 | | tag_ids | query | Tag IDs to filter by. | No | [ string ] | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | List of knowledge bases. | **application/json**: [DatasetListResponse](#datasetlistresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | ### [POST] /datasets **Create an Empty Knowledge Base** Create a new empty knowledge base. After creation, use [Create Document by Text](/api-reference/documents/create-document-by-text) or [Create Document by File](/api-reference/documents/create-document-by-file) to add documents. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [DatasetCreatePayload](#datasetcreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Knowledge base created successfully. | **application/json**: [DatasetDetailResponse](#datasetdetailresponse)
| | 400 | Bad request - invalid parameters | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 409 | `dataset_name_duplicate` : The dataset name already exists. Please modify your dataset name. | | ### [DELETE] /datasets/{dataset_id} **Delete Knowledge Base** Permanently delete a knowledge base and all its documents. The knowledge base must not be in use by any application. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Responses | Code | Description | | ---- | ----------- | | 204 | Success. | | 401 | Unauthorized - invalid API token | | 403 | Forbidden - dataset API access or workspace access denied | | 404 | `not_found` : Dataset not found. | | 409 | `dataset_in_use` : The knowledge base is being used by some apps. Please remove it from the apps before deleting. | ### [GET] /datasets/{dataset_id} **Get Knowledge Base** Retrieve detailed information about a specific knowledge base, including its embedding model, retrieval configuration, and document statistics. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Knowledge base details. | **application/json**: [DatasetDetailWithPartialMembersResponse](#datasetdetailwithpartialmembersresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | `forbidden` : Insufficient permissions to access this knowledge base. | | | 404 | `not_found` : Dataset not found. | | ### [PATCH] /datasets/{dataset_id} **Update Knowledge Base** Update the name, description, permissions, or retrieval settings of an existing knowledge base. Only the fields provided in the request body are updated. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [DatasetUpdatePayload](#datasetupdatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Knowledge base updated successfully. | **application/json**: [DatasetDetailWithPartialMembersResponse](#datasetdetailwithpartialmembersresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | `forbidden` : Insufficient permissions to access this knowledge base. | | | 404 | `not_found` : Dataset not found. | | ### [POST] /datasets/{dataset_id}/hit-testing **Retrieve Chunks from a Knowledge Base / Test Retrieval** Performs a search query against a knowledge base to retrieve the most relevant chunks. This endpoint can be used for both production retrieval and test retrieval. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [HitTestingPayload](#hittestingpayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Retrieval results. | **application/json**: [HitTestingResponse](#hittestingresponse)
| | 400 | - `dataset_not_initialized` : The dataset is still being initialized or indexing. Please wait a moment. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `provider_quota_exceeded` : Your quota for Dify Hosted OpenAI has been exhausted. Please go to Settings -> Model Provider to complete your own provider credentials. - `model_currently_not_support` : Dify Hosted OpenAI trial currently not support the GPT-4 model. - `completion_request_error` : Completion request failed. - `invalid_param` : Invalid parameter value. | | | 401 | Unauthorized - invalid API token | | | 403 | `forbidden` : Insufficient permissions. | | | 404 | `not_found` : Knowledge base not found. | | | 500 | `internal_server_error` : An internal error occurred during retrieval. | | ### [POST] /datasets/{dataset_id}/retrieve **Retrieve Chunks from a Knowledge Base / Test Retrieval** Performs a search query against a knowledge base to retrieve the most relevant chunks. This endpoint can be used for both production retrieval and test retrieval. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [HitTestingPayload](#hittestingpayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Retrieval results. | **application/json**: [HitTestingResponse](#hittestingresponse)
| | 400 | - `dataset_not_initialized` : The dataset is still being initialized or indexing. Please wait a moment. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `provider_quota_exceeded` : Your quota for Dify Hosted OpenAI has been exhausted. Please go to Settings -> Model Provider to complete your own provider credentials. - `model_currently_not_support` : Dify Hosted OpenAI trial currently not support the GPT-4 model. - `completion_request_error` : Completion request failed. - `invalid_param` : Invalid parameter value. | | | 401 | Unauthorized - invalid API token | | | 403 | `forbidden` : Insufficient permissions. | | | 404 | `not_found` : Knowledge base not found. | | | 500 | `internal_server_error` : An internal error occurred during retrieval. | | --- ## default ### [POST] /datasets/pipeline/file-upload **Upload Pipeline File** Upload a file for use in a knowledge pipeline. Accepts a single file via `multipart/form-data`. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **multipart/form-data**: { **"file"**: binary }
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 201 | File uploaded successfully. | **application/json**: [PipelineUploadFileResponse](#pipelineuploadfileresponse)
| | 400 | - `no_file_uploaded` : Please upload your file. - `filename_not_exists_error` : The specified filename does not exist. - `too_many_files` : Only one file is allowed. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 413 | `file_too_large` : File size exceeded. | | | 415 | `unsupported_file_type` : File type not allowed. | | ### [GET] /datasets/{dataset_id}/pipeline/datasource-plugins **List Datasource Plugins** List the datasource nodes configured in the knowledge pipeline. Each node includes the plugin it uses plus the metadata needed to run it. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | is_published | query | Whether to retrieve nodes from the published or draft pipeline. `true` returns nodes from the published version, `false` returns nodes from the draft. | No | boolean,
**Default:** true | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | List of datasource nodes configured in the pipeline. | **application/json**: [DatasourcePluginListResponse](#datasourcepluginlistresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | `not_found` : Dataset not found. | | ### [POST] /datasets/{dataset_id}/pipeline/datasource/nodes/{node_id}/run **Run Datasource Node** Execute a single datasource node within the knowledge pipeline. Returns a streaming response with the node execution results. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | node_id | path | ID of the datasource node to execute. | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [DatasourceNodeRunPayload](#datasourcenoderunpayload)
| #### Responses | Code | Description | | ---- | ----------- | | 200 | Streaming response with node execution events. | | 401 | Unauthorized - invalid API token | | 403 | Forbidden - dataset API access or workspace access denied | | 404 | `not_found` : Dataset not found. | ### [POST] /datasets/{dataset_id}/pipeline/run **Run Pipeline** Execute the full knowledge pipeline for a knowledge base. Supports both streaming and blocking response modes. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [PipelineRunApiEntity](#pipelinerunapientity)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Pipeline execution result. Format depends on `response_mode`: streaming returns a `text/event-stream`, blocking returns a JSON object. | **application/json**: [GeneratedAppResponse](#generatedappresponse)
**text/event-stream**: [GeneratedAppResponse](#generatedappresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | `forbidden` : Forbidden. | | | 404 | `not_found` : Dataset not found. | | | 500 | `pipeline_run_error` : Pipeline execution failed. | | --- ## default ### [DELETE] /datasets/tags **Delete Knowledge Tag** Permanently delete a knowledge base tag. Does not delete the knowledge bases that were tagged. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [TagDeletePayload](#tagdeletepayload)
| #### Responses | Code | Description | | ---- | ----------- | | 204 | Success. | | 401 | Unauthorized - invalid API token | | 403 | Forbidden - insufficient permissions | ### [GET] /datasets/tags **List Knowledge Tags** Returns the list of all knowledge base tags in the workspace. #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | List of tags. | **application/json**: [KnowledgeTagListResponse](#knowledgetaglistresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | ### [PATCH] /datasets/tags **Update Knowledge Tag** Rename an existing knowledge base tag. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [TagUpdatePayload](#tagupdatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Tag updated successfully. | **application/json**: [KnowledgeTagResponse](#knowledgetagresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - insufficient permissions | | ### [POST] /datasets/tags **Create Knowledge Tag** Create a new tag for organizing knowledge bases. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [TagCreatePayload](#tagcreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Tag created successfully. | **application/json**: [KnowledgeTagResponse](#knowledgetagresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - insufficient permissions | | ### [POST] /datasets/tags/binding **Create Tag Binding** Bind one or more tags to a knowledge base. A knowledge base can have multiple tags. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [TagBindingPayload](#tagbindingpayload)
| #### Responses | Code | Description | | ---- | ----------- | | 204 | Success. | | 401 | Unauthorized - invalid API token | | 403 | Forbidden - insufficient permissions | ### [POST] /datasets/tags/unbinding **Delete Tag Binding** Remove one or more tags from a knowledge base. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [TagUnbindingPayload](#tagunbindingpayload)
| #### Responses | Code | Description | | ---- | ----------- | | 204 | Success. | | 401 | Unauthorized - invalid API token | | 403 | Forbidden - insufficient permissions | ### [GET] /datasets/{dataset_id}/tags **Get Knowledge Base Tags** Returns the list of tags bound to a specific knowledge base. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Tags bound to the knowledge base. | **application/json**: [DatasetBoundTagListResponse](#datasetboundtaglistresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | --- ## default ### [POST] /datasets/{dataset_id}/document/create-by-file **Create Document by File** Create a document by uploading a file. Supports common document formats (PDF, TXT, DOCX, etc.). Processing is asynchronous — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **multipart/form-data**: { **"data"**: string, **"file"**: binary }
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document created successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)
| | 400 | - `no_file_uploaded` : Please upload your file. - `too_many_files` : Only one file is allowed. - `filename_not_exists_error` : The specified filename does not exist. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, external datasets not supported, unsupported file type, missing required fields, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 413 | `file_too_large` : File size exceeded. | | ### [POST] /datasets/{dataset_id}/document/create-by-text **Create Document by Text** Create a document from raw text content. The document is processed asynchronously — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [DocumentTextCreatePayload](#documenttextcreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document created successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)
| | 400 | - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist. / indexing_technique is required. / Invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | ### ~~[POST] /datasets/{dataset_id}/document/create_by_file~~ ***DEPRECATED*** **Create Document by File** Create a document by uploading a file. Supports common document formats (PDF, TXT, DOCX, etc.). Processing is asynchronous — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **multipart/form-data**: { **"data"**: string, **"file"**: binary }
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document created successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)
| | 400 | - `no_file_uploaded` : Please upload your file. - `too_many_files` : Only one file is allowed. - `filename_not_exists_error` : The specified filename does not exist. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, external datasets not supported, unsupported file type, missing required fields, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 413 | `file_too_large` : File size exceeded. | | ### [GET] /datasets/{dataset_id}/documents **List Documents** Returns a paginated list of documents in the knowledge base. Supports filtering by keyword and indexing status. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | keyword | query | Search keyword to filter by document name. | No | string | | limit | query | Number of items per page. Server caps at `100`. | No | integer,
**Default:** 20 | | page | query | Page number to retrieve. | No | integer,
**Default:** 1 | | status | query | Filter by display status. | No | string,
**Available values:** "archived", "available", "disabled", "error", "indexing", "paused", "queuing" | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | List of documents. | **application/json**: [DocumentListResponse](#documentlistresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | `not_found` : Knowledge base not found. | | ### [POST] /datasets/{dataset_id}/documents/download-zip **Download Documents as ZIP** Download multiple uploaded-file documents as a single ZIP archive. Accepts up to `100` document IDs. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [DocumentBatchDownloadZipPayload](#documentbatchdownloadzippayload)
| #### Responses | Code | Description | | ---- | ----------- | | 200 | ZIP archive containing the requested documents. | | 401 | Unauthorized - invalid API token | | 403 | `forbidden` : Insufficient permissions. | | 404 | `not_found` : Document or dataset not found. | ### [PATCH] /datasets/{dataset_id}/documents/status/{action} **Update Document Status in Batch** Enable, disable, archive, or unarchive multiple documents at once. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | action | path | Action to perform: 'enable', 'disable', 'archive', or 'un_archive' | Yes | string,
**Available values:** "archive", "disable", "enable", "un_archive" | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [DocumentStatusPayload](#documentstatuspayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document status updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)
| | 400 | `invalid_action` : Invalid action. | | | 401 | Unauthorized - invalid API token | | | 403 | `forbidden` : Insufficient permissions. | | | 404 | `not_found` : Knowledge base not found. | | ### [GET] /datasets/{dataset_id}/documents/{batch}/indexing-status **Get Document Indexing Status** Check the indexing progress of documents in a batch. Returns the current processing stage and chunk completion counts for each document. Poll this endpoint until `indexing_status` reaches `completed` or `error`. The status progresses through: `waiting` → `parsing` → `cleaning` → `splitting` → `indexing` → `completed`. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | batch | path | Batch ID. | Yes | string | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Indexing status for documents in the batch. | **application/json**: [DocumentStatusListResponse](#documentstatuslistresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | `not_found` : Knowledge base not found. / Documents not found. | | ### [DELETE] /datasets/{dataset_id}/documents/{document_id} **Delete Document** Permanently delete a document and all its chunks from the knowledge base. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | #### Responses | Code | Description | | ---- | ----------- | | 204 | Success. | | 400 | `document_indexing` : Cannot delete document during indexing. | | 401 | Unauthorized - invalid API token | | 403 | `archived_document_immutable` : The archived document is not editable. | | 404 | `not_found` : Document Not Exists. | ### [GET] /datasets/{dataset_id}/documents/{document_id} **Get Document** Retrieve detailed information about a specific document, including its indexing status, metadata, and processing statistics. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | | metadata | query | `all` returns all fields including metadata. `only` returns only `id`, `doc_type`, and `doc_metadata`. `without` returns all fields except `doc_metadata`. | No | string,
**Available values:** "all", "only", "without",
**Default:** all | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document details. The response shape varies based on the `metadata` query parameter. When `metadata` is `only`, only `id`, `doc_type`, and `doc_metadata` are returned. When `metadata` is `without`, `doc_type` and `doc_metadata` are omitted. | **application/json**: [DocumentDetailResponse](#documentdetailresponse)
| | 400 | `invalid_metadata` : Invalid metadata value for the specified key. | | | 401 | Unauthorized - invalid API token | | | 403 | `forbidden` : No permission. | | | 404 | `not_found` : Document not found. | | ### [PATCH] /datasets/{dataset_id}/documents/{document_id} **Update Document by File** Update an existing document by uploading a new file. Re-triggers indexing — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | No | **multipart/form-data**: { **"data"**: string, **"file"**: binary }
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document updated successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)
| | 400 | - `too_many_files` : Only one file is allowed. - `filename_not_exists_error` : The specified filename does not exist. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, external datasets not supported, unsupported file type, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Document not found | | | 413 | `file_too_large` : File size exceeded. | | ### [GET] /datasets/{dataset_id}/documents/{document_id}/download **Download Document** Get a signed download URL for a document's original uploaded file. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Download URL generated successfully. | **application/json**: [UrlResponse](#urlresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | `forbidden` : No permission to access this document. | | | 404 | `not_found` : Document not found. | | ### ~~[POST] /datasets/{dataset_id}/documents/{document_id}/update-by-file~~ ***DEPRECATED*** **Update Document by File** Update an existing document by uploading a new file. Re-triggers indexing — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | No | **multipart/form-data**: { **"data"**: string, **"file"**: binary }
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document updated successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)
| | 400 | - `too_many_files` : Only one file is allowed. - `filename_not_exists_error` : The specified filename does not exist. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, external datasets not supported, unsupported file type, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Document not found | | | 413 | `file_too_large` : File size exceeded. | | ### [POST] /datasets/{dataset_id}/documents/{document_id}/update-by-text **Update Document by Text** Update an existing document's text content, name, or processing configuration. Re-triggers indexing if content changes — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [DocumentTextUpdate](#documenttextupdate)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document updated successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)
| | 400 | - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, name is required when text is provided, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Document not found | | ### ~~[POST] /datasets/{dataset_id}/documents/{document_id}/update_by_file~~ ***DEPRECATED*** **Update Document by File** Update an existing document by uploading a new file. Re-triggers indexing — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | No | **multipart/form-data**: { **"data"**: string, **"file"**: binary }
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document updated successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)
| | 400 | - `too_many_files` : Only one file is allowed. - `filename_not_exists_error` : The specified filename does not exist. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, external datasets not supported, unsupported file type, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Document not found | | | 413 | `file_too_large` : File size exceeded. | | --- ## default ### [POST] /datasets/{dataset_id}/documents/metadata **Update Document Metadata in Batch** Update metadata values for multiple documents at once. Each document in the request receives the specified metadata key-value pairs. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [MetadataOperationData](#metadataoperationdata)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Document metadata updated successfully. | **application/json**: [DatasetMetadataActionResponse](#datasetmetadataactionresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Dataset, document, or metadata not found | | ### [GET] /datasets/{dataset_id}/metadata **List Metadata Fields** Returns the list of all metadata fields (both custom and built-in) for the knowledge base, along with the count of documents using each field. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Metadata fields for the knowledge base. | **application/json**: [DatasetMetadataListResponse](#datasetmetadatalistresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Dataset not found | | ### [POST] /datasets/{dataset_id}/metadata **Create Metadata Field** Create a custom metadata field for the knowledge base. Metadata fields can be used to annotate documents with structured information. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [MetadataArgs](#metadataargs)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 201 | Metadata field created successfully. | **application/json**: [DatasetMetadataResponse](#datasetmetadataresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Dataset not found | | ### [GET] /datasets/{dataset_id}/metadata/built-in **Get Built-in Metadata Fields** Returns the list of built-in metadata fields provided by the system (e.g., document type, source URL). #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Built-in metadata fields. | **application/json**: [DatasetMetadataBuiltInFieldsResponse](#datasetmetadatabuiltinfieldsresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | ### [POST] /datasets/{dataset_id}/metadata/built-in/{action} **Update Built-in Metadata Field** Enable or disable built-in metadata fields for the knowledge base. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | action | path | `enable` to activate built-in metadata fields, `disable` to deactivate them. | Yes | string,
**Available values:** "disable", "enable" | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Built-in metadata field toggled successfully. | **application/json**: [DatasetMetadataActionResponse](#datasetmetadataactionresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Dataset not found | | ### [DELETE] /datasets/{dataset_id}/metadata/{metadata_id} **Delete Metadata Field** Permanently delete a custom metadata field. Documents using this field will lose their metadata values for it. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | metadata_id | path | Metadata field ID. | Yes | string (uuid) | #### Responses | Code | Description | | ---- | ----------- | | 204 | Success. | | 401 | Unauthorized - invalid API token | | 403 | Forbidden - dataset API access or workspace access denied | | 404 | Dataset or metadata not found | ### [PATCH] /datasets/{dataset_id}/metadata/{metadata_id} **Update Metadata Field** Rename a custom metadata field. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | metadata_id | path | Metadata field ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [MetadataUpdatePayload](#metadataupdatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Metadata field updated successfully. | **application/json**: [DatasetMetadataResponse](#datasetmetadataresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Dataset or metadata not found | | --- ## default ### [GET] /datasets/{dataset_id}/documents/{document_id}/segments **List Chunks** Returns a paginated list of chunks within a document. Supports filtering by keyword and status. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | | keyword | query | Search keyword. | No | string | | limit | query | Number of items per page. Server caps at `100`. | No | integer,
**Default:** 20 | | page | query | Page number to retrieve. | No | integer,
**Default:** 1 | | status | query | Filter chunks by indexing status, such as `completed`, `indexing`, or `error`. | No | [ string ] | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | List of chunks. | **application/json**: [SegmentListResponse](#segmentlistresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Dataset or document not found | | ### [POST] /datasets/{dataset_id}/documents/{document_id}/segments **Create Chunks** Create one or more chunks within a document. Each chunk can include optional keywords and an answer field (for QA-mode documents). #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [SegmentCreatePayload](#segmentcreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Chunks created successfully. | **application/json**: [SegmentCreateListResponse](#segmentcreatelistresponse)
| | 400 | Bad request - segments data is missing | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | `not_found` : Document is not completed or is disabled. | | ### [DELETE] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id} **Delete Chunk** Permanently delete a chunk from the document. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | | segment_id | path | Chunk ID. | Yes | string (uuid) | #### Responses | Code | Description | | ---- | ----------- | | 204 | Success. | | 401 | Unauthorized - invalid API token | | 403 | Forbidden - dataset API access or workspace access denied | | 404 | Dataset, document, or segment not found | ### [GET] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id} **Get Chunk** Retrieve detailed information about a specific chunk, including its content, keywords, and indexing status. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | | segment_id | path | Chunk ID. | Yes | string (uuid) | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Chunk details. | **application/json**: [SegmentDetailResponse](#segmentdetailresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Dataset, document, or segment not found | | ### [POST] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id} **Update Chunk** Update a chunk's content, keywords, or answer. Re-triggers indexing for the modified chunk. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | | segment_id | path | Chunk ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [SegmentUpdatePayload](#segmentupdatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Chunk updated successfully. | **application/json**: [SegmentDetailResponse](#segmentdetailresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Dataset, document, or segment not found | | ### [GET] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks **List Child Chunks** Returns a paginated list of child chunks under a specific parent chunk. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | | segment_id | path | Chunk ID. | Yes | string (uuid) | | keyword | query | Search keyword. | No | string | | limit | query | Number of items per page. Server caps at `100`. | No | integer,
**Default:** 20 | | page | query | Page number to retrieve. | No | integer,
**Default:** 1 | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | List of child chunks. | **application/json**: [ChildChunkListResponse](#childchunklistresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Dataset, document, or segment not found | | ### [POST] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks **Create Child Chunk** Create a child chunk under the specified segment. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | | segment_id | path | Chunk ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [ChildChunkCreatePayload](#childchunkcreatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Child chunk created successfully. | **application/json**: [ChildChunkDetailResponse](#childchunkdetailresponse)
| | 400 | `invalid_param` : Create child chunk index failed. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Dataset, document, or segment not found | | ### [DELETE] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks/{child_chunk_id} **Delete Child Chunk** Permanently delete a child chunk from its parent chunk. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | child_chunk_id | path | Child chunk ID. | Yes | string (uuid) | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | | segment_id | path | Chunk ID. | Yes | string (uuid) | #### Responses | Code | Description | | ---- | ----------- | | 204 | Success. | | 400 | `invalid_param` : Delete child chunk index failed. | | 401 | Unauthorized - invalid API token | | 403 | Forbidden - dataset API access or workspace access denied | | 404 | Dataset, document, segment, or child chunk not found | ### [PATCH] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks/{child_chunk_id} **Update Child Chunk** Update the content of an existing child chunk. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | child_chunk_id | path | Child chunk ID. | Yes | string (uuid) | | dataset_id | path | Knowledge base ID. | Yes | string (uuid) | | document_id | path | Document ID. | Yes | string (uuid) | | segment_id | path | Chunk ID. | Yes | string (uuid) | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [ChildChunkUpdatePayload](#childchunkupdatepayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Child chunk updated successfully. | **application/json**: [ChildChunkDetailResponse](#childchunkdetailresponse)
| | 400 | `invalid_param` : Update child chunk index failed. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - dataset API access or workspace access denied | | | 404 | Dataset, document, segment, or child chunk not found | | --- ## default ### [GET] /end-users/{end_user_id} **Get End User Info** Retrieve an end user by ID. Useful when other APIs return an end-user ID (e.g., `created_by` from [Upload File](/api-reference/files/upload-file)). #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | end_user_id | path | End user ID | Yes | string (uuid) | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | End user retrieved successfully. | **application/json**: [EndUserDetail](#enduserdetail)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `end_user_not_found` : End user not found. | | --- ## default ### [POST] /files/upload **Upload File** Upload a file for use when sending messages, enabling multimodal understanding of images, documents, audio, and video. Uploaded files are for use by the current end-user only. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **multipart/form-data**: { **"file"**: binary, **"user"**: string }
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 201 | File uploaded successfully. | **application/json**: [FileResponse](#fileresponse)
| | 400 | - `no_file_uploaded` : No file was provided in the request. - `too_many_files` : Only one file is allowed per request. - `filename_not_exists_error` : The uploaded file has no filename. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 413 | `file_too_large` : File size exceeded. | | | 415 | `unsupported_file_type` : File type not allowed. | | ### [GET] /files/{file_id}/preview **Download File** Preview or download uploaded files previously uploaded via the [Upload File](/api-reference/files/upload-file) API. Files can only be accessed if they belong to messages within the requesting application. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | file_id | path | The unique identifier of the file to preview, obtained from the [Upload File](/api-reference/files/upload-file) API response. | Yes | string (uuid) | | as_attachment | query | If `true`, forces the file to download as an attachment instead of previewing in browser. | No | boolean | | user | query | User identifier, used for end-user context. | No | string | #### Responses | Code | Description | | ---- | ----------- | | 200 | Returns the raw file content. The `Content-Type` header is set to the file's MIME type. If `as_attachment` is `true`, the file is returned as a download with `Content-Disposition: attachment`. | | 401 | Unauthorized - invalid API token | | 403 | `file_access_denied` : Access to the requested file is denied. | | 404 | `file_not_found` : The requested file was not found. | --- ## default ### [GET] /form/human_input/{form_token} **Get Human Input Form** Retrieve a paused Human Input form's contents using the `form_token` from a `human_input_required` event. Requires **WebApp** delivery. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | form_token | path | Human input form token | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Form contents retrieved successfully. | **application/json**: [HumanInputFormDefinitionResponse](#humaninputformdefinitionresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Form not found. | | | 412 | - `human_input_form_submitted` : Form already submitted. Forms are one-shot; the first response wins regardless of which user submits it. - `human_input_form_expired` : The form's expiration time passed before submission arrived. | | ### [POST] /form/human_input/{form_token} **Submit Human Input Form** Submit the recipient's response to a paused Human Input form. The workflow resumes on acceptance; use [Stream Workflow Events](/api-reference/chatflows/stream-workflow-events) to follow subsequent events. Requires **WebApp** delivery. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | form_token | path | Human input form token | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [HumanInputFormSubmitPayloadWithUser](#humaninputformsubmitpayloadwithuser)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Form submitted successfully. The response body is an empty object. | **application/json**: [HumanInputFormSubmitResponse](#humaninputformsubmitresponse)
| | 400 | - `bad_request` : Form recipient type is invalid. - `invalid_form_data` : Submission failed validation against the form definition. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Form not found. | | | 412 | - `human_input_form_submitted` : Form already submitted. Forms are one-shot; the first response wins regardless of which user submits it. - `human_input_form_expired` : The form's expiration time passed before submission arrived. | | --- ## default ### [GET] /info **Get App Info** Retrieve basic information about this application, including name, description, tags, and mode. #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Basic information of the application. | **application/json**: [AppInfoResponse](#appinforesponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | Application not found | | ### [GET] /meta **Get App Meta** Retrieve metadata about this application, including tool icons and other configuration details. #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successfully retrieved application meta information. | **application/json**: [AppMetaResponse](#appmetaresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | Application not found | | ### [GET] /parameters **Get App Parameters** Retrieve the application's input form configuration, including feature switches, input parameter names, types, and default values. #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Application parameters information. | **application/json**: [Parameters](#parameters)
| | 400 | `app_unavailable` : App unavailable or misconfigured. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | Application not found | | ### [GET] /site **Get App WebApp Settings** Retrieve the WebApp settings of this application, including site configuration, theme, and customization options. #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | WebApp settings of the application. | **application/json**: [Site](#site)
| | 401 | Unauthorized - invalid API token | | | 403 | `forbidden` : Site not found for this application or the workspace has been archived. | | --- ## default ### [GET] /workflow/{task_id}/events **Stream Workflow Events** Resume the Server-Sent Events stream for a workflow run after a pause or a dropped SSE connection. For runs that have already finished, the stream emits a single `workflow_finished` event and closes. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | task_id | path | Workflow run ID returned by the original workflow run request. | Yes | string | | continue_on_pause | query | Set to `true` to keep the stream open across multiple `workflow_paused` events, which is useful when the workflow has more than one Human Input node in sequence. By default, the stream closes after the first pause. | No | boolean | | include_state_snapshot | query | When `true`, replay from the persisted state snapshot to include a status summary of already-executed nodes before streaming new events. | No | boolean | | user | query | End-user identifier that originally triggered the run. Must match the creator of the run. | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Server-Sent Events stream. Each event is delivered as `data: {JSON}\\n\\n`. Event payloads follow the same schemas as the original streaming response. | **text/event-stream**: [EventStreamResponse](#eventstreamresponse)
| | 400 | `not_workflow_app` : Please check if your app mode matches the right API route. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Workflow run not found. | | ### [GET] /workflows/logs **List Workflow Logs** Retrieve paginated workflow execution logs with filtering options. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | created_at__after | query | Filter logs created after this ISO 8601 timestamp. | No | dateTime | | created_at__before | query | Filter logs created before this ISO 8601 timestamp. | No | dateTime | | created_by_account | query | Filter by account ID. | No | string | | created_by_end_user_session_id | query | Filter by end user session ID. | No | string | | keyword | query | Keyword to search in logs. | No | string | | limit | query | Number of items per page. | No | integer,
**Default:** 20 | | page | query | Page number for pagination. | No | integer,
**Default:** 1 | | status | query | Filter by execution status. | No | string,
**Available values:** "failed", "stopped", "succeeded" | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successfully retrieved workflow logs. | **application/json**: [WorkflowAppLogPaginationResponse](#workflowapplogpaginationresponse)
| | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | ### [POST] /workflows/run **Run Workflow** Execute a workflow. Cannot be executed without a published workflow. #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [WorkflowRunPayloadWithUser](#workflowrunpayloadwithuser)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successful response. The content type and structure depend on the `response_mode` parameter in the request. - If `response_mode` is `blocking`, returns `application/json` with a `WorkflowBlockingResponse` object. - If `response_mode` is `streaming`, returns `text/event-stream` with a stream of `ChunkWorkflowEvent` objects. | **application/json**: [GeneratedAppResponse](#generatedappresponse)
**text/event-stream**: [GeneratedAppResponse](#generatedappresponse)
| | 400 | - `not_workflow_app` : App mode does not match the API route. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model unavailable. - `completion_request_error` : Workflow execution request failed. - `invalid_param` : Invalid parameter value. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | Workflow not found | | | 429 | - `too_many_requests` : Too many concurrent requests for this app. - `rate_limit_error` : The upstream model provider rate limit was exceeded. | | | 500 | `internal_server_error` : Internal server error. | | ### [GET] /workflows/run/{workflow_run_id} **Get Workflow Run Detail** Retrieve the current execution results of a workflow task based on the workflow execution ID. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | workflow_run_id | path | Workflow run ID, obtained from the workflow execution response or streaming events. | Yes | string | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successfully retrieved workflow run details. | **application/json**: [WorkflowRunResponse](#workflowrunresponse)
| | 400 | `not_workflow_app` : App mode does not match the API route. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | `not_found` : Workflow run not found. | | ### [POST] /workflows/tasks/{task_id}/stop **Stop Workflow Task** Stop a running workflow task. Only supported in `streaming` mode. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | task_id | path | Task ID, obtained from the streaming chunk returned by the Run Workflow API. | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [RequiredServiceApiUserPayload](#requiredserviceapiuserpayload)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)
| | 400 | - `not_workflow_app` : App mode does not match the API route. - `invalid_param` : Required parameter missing or invalid. | | | 401 | Unauthorized - invalid API token | | | 403 | Forbidden - token scope, app, dataset, or workspace access denied | | | 404 | Task not found | | ### [POST] /workflows/{workflow_id}/run **Run Workflow by ID** Execute a specific workflow version identified by its ID. Useful for running a particular published version of the workflow. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | workflow_id | path | Workflow ID of the specific version to execute. This value is returned in the `workflow_id` field of workflow run responses. | Yes | string | #### Request Body | Required | Schema | | -------- | ------ | | Yes | **application/json**: [WorkflowRunPayloadWithUser](#workflowrunpayloadwithuser)
| #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Successful response. The content type and structure depend on the `response_mode` parameter in the request. - If `response_mode` is `blocking`, returns `application/json` with a `WorkflowBlockingResponse` object. - If `response_mode` is `streaming`, returns `text/event-stream` with a stream of `ChunkWorkflowEvent` objects. | **application/json**: [GeneratedAppResponse](#generatedappresponse)
**text/event-stream**: [GeneratedAppResponse](#generatedappresponse)
| | 400 | - `not_workflow_app` : App mode does not match the API route. - `bad_request` : Workflow is a draft or has an invalid ID format. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model unavailable. - `completion_request_error` : Workflow execution request failed. - `invalid_param` : Required parameter missing or invalid. | | | 401 | Unauthorized - invalid API token | | | 403 | `workflow_version_execution_not_allowed` : Workflow version execution is unavailable on the current plan. Upgrade to a paid plan. | | | 404 | `not_found` : Workflow not found. | | | 429 | - `too_many_requests` : Too many concurrent requests for this app. - `rate_limit_error` : The upstream model provider rate limit was exceeded. | | | 500 | `internal_server_error` : Internal server error. | | --- ## default ### [GET] /workspaces/current/models/model-types/{model_type} **Get Available Models** Retrieve the list of available models by type. Primarily used to query `text-embedding` and `rerank` models for knowledge base configuration. #### Parameters | Name | Located in | Description | Required | Schema | | ---- | ---------- | ----------- | -------- | ------ | | model_type | path | Type of model to retrieve. | Yes | string,
**Available values:** "llm", "moderation", "rerank", "speech2text", "text-embedding", "tts" | #### Responses | Code | Description | Schema | | ---- | ----------- | ------ | | 200 | Available models for the specified type. | **application/json**: [ProviderWithModelsListResponse](#providerwithmodelslistresponse)
| | 401 | Unauthorized - invalid API token | | --- ### Schemas #### AgentThought | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | answer | string | | No | | chain_id | string | | No | | created_at | integer | | No | | files | [ string ] | | Yes | | id | string | | Yes | | message_id | string | | Yes | | observation | string | | No | | position | integer | | Yes | | thought | string | | No | | tool | string | | No | | tool_input | string | | No | | tool_labels | [JSONValue](#jsonvalue) | | Yes | #### Annotation | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | answer | string | | No | | created_at | integer | | No | | hit_count | integer | | No | | id | string | | Yes | | question | string | | No | #### AnnotationCreatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | answer | string | Annotation answer. | Yes | | question | string | Annotation question. | Yes | #### AnnotationJobStatusDetailResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | error_msg | string | | No | | job_id | string | | Yes | | job_status | string
string | | Yes | #### AnnotationJobStatusResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | job_id | string | | Yes | | job_status | string
string | | Yes | #### AnnotationList | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [Annotation](#annotation) ] | | Yes | | has_more | boolean | | Yes | | limit | integer | | Yes | | page | integer | | Yes | | total | integer | | Yes | #### AnnotationListQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | keyword | string | Keyword to filter annotations by question or answer content. | No | | limit | integer,
**Default:** 20 | Number of items per page. | No | | page | integer,
**Default:** 1 | Page number for pagination. | No | #### AnnotationReplyActionPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | embedding_model_name | string | Name of the embedding model to use for annotation matching. | Yes | | embedding_provider_name | string | Name of the embedding model provider. | Yes | | score_threshold | float | Minimum similarity score for an annotation to be considered a match. Higher values require closer matches. | Yes | #### AppFeedbackListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [AppFeedbackResponse](#appfeedbackresponse) ] | | Yes | #### AppFeedbackResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | app_id | string | | Yes | | content | string | | No | | conversation_id | string | | Yes | | created_at | string | | Yes | | from_account_id | string | | No | | from_end_user_id | string | | No | | from_source | string | | Yes | | id | string | | Yes | | message_id | string | | Yes | | rating | string | | Yes | | updated_at | string | | Yes | #### AppInfoResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | author_name | string | | Yes | | description | string | | Yes | | mode | string | | Yes | | name | string | | Yes | | tags | [ string ] | | Yes | #### AppMetaResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | tool_icons | object | | No | #### AudioBinaryResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | AudioBinaryResponse | string | | | #### AudioTranscriptResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | text | string | | Yes | #### BinaryFileResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | BinaryFileResponse | string | | | #### ButtonStyle Button styles for user actions. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | ButtonStyle | string | Button styles for user actions. | | #### ChatRequestPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | auto_generate_name | boolean,
**Default:** true | Auto-generate the conversation title. If `false`, use the Rename Conversation API with `auto_generate: true` to generate the title asynchronously. | No | | conversation_id | string | Conversation ID to continue a conversation. Omit this field or pass an empty string to start a new conversation, then pass the returned `conversation_id` in subsequent requests. | No | | files | [ object ] | File list for multimodal understanding, including images, documents, audio, and video. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No | | inputs | object | Values for app-defined variables. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover expected variable names and types. | Yes | | query | string | User input or question content. | Yes | | response_mode | string | Response mode. `streaming` uses Server-Sent Events; `blocking` returns after completion. New Agent app mode supports streaming only. When omitted, non-Agent apps run in blocking mode and new Agent apps stream. | No | | workflow_id | string | Published workflow version ID to execute for advanced chat. If omitted, the app's current published workflow is used. | No | #### ChatRequestPayloadWithUser | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | auto_generate_name | boolean,
**Default:** true | Auto-generate the conversation title. If `false`, use the Rename Conversation API with `auto_generate: true` to generate the title asynchronously. | No | | conversation_id | string | Conversation ID to continue a conversation. Omit this field or pass an empty string to start a new conversation, then pass the returned `conversation_id` in subsequent requests. | No | | files | [ object ] | File list for multimodal understanding, including images, documents, audio, and video. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No | | inputs | object | Values for app-defined variables. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover expected variable names and types. | Yes | | query | string | User input or question content. | Yes | | response_mode | string | Response mode. `streaming` uses Server-Sent Events; `blocking` returns after completion. New Agent app mode supports streaming only. When omitted, non-Agent apps run in blocking mode and new Agent apps stream. | No | | user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | Yes | | workflow_id | string | Published workflow version ID to execute for advanced chat. If omitted, the app's current published workflow is used. | No | #### ChildChunkCreatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | content | string | Child chunk text content. | Yes | #### ChildChunkDetailResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ChildChunkResponse](#childchunkresponse) | | Yes | #### ChildChunkListQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | keyword | string | Search keyword. | No | | limit | integer,
**Default:** 20 | Number of items per page. Server caps at `100`. | No | | page | integer,
**Default:** 1 | Page number to retrieve. | No | #### ChildChunkListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [ChildChunkResponse](#childchunkresponse) ] | | Yes | | limit | integer | | Yes | | page | integer | | Yes | | total | integer | | Yes | | total_pages | integer | | Yes | #### ChildChunkResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | content | string | | Yes | | created_at | integer | | Yes | | id | string | | Yes | | position | integer | | Yes | | segment_id | string | | Yes | | type | string | | Yes | | updated_at | integer | | Yes | | word_count | integer | | Yes | #### ChildChunkUpdatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | content | string | Child chunk text content. | Yes | #### CompletionRequestPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | files | [ object ] | File list for multimodal understanding, including images, documents, audio, and video. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No | | inputs | object | Values for app-defined variables. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover expected variable names and types. | Yes | | query | string | User input or prompt content. | No | | response_mode | string | Response mode. `streaming` uses Server-Sent Events; `blocking` returns after completion. When omitted, the request runs in blocking mode. | No | #### CompletionRequestPayloadWithUser | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | files | [ object ] | File list for multimodal understanding, including images, documents, audio, and video. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No | | inputs | object | Values for app-defined variables. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover expected variable names and types. | Yes | | query | string | User input or prompt content. | No | | response_mode | string | Response mode. `streaming` uses Server-Sent Events; `blocking` returns after completion. When omitted, the request runs in blocking mode. | No | | user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | Yes | #### Condition Condition detail | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | comparison_operator | string,
**Available values:** "<", "=", ">", "after", "before", "contains", "empty", "end with", "in", "is", "is not", "not contains", "not empty", "not in", "start with", "≠", "≤", "≥" | Comparison to apply. String operators (`contains`, `not contains`, `start with`, `end with`, `is`, `is not`, `empty`, `not empty`, `in`, `not in`) act on string or array metadata; numeric operators (`=`, `≠`, `>`, `<`, `≥`, `≤`) act on numeric metadata; time operators (`before`, `after`) act on time metadata.
*Enum:* `"<"`, `"="`, `">"`, `"after"`, `"before"`, `"contains"`, `"empty"`, `"end with"`, `"in"`, `"is"`, `"is not"`, `"not contains"`, `"not empty"`, `"not in"`, `"start with"`, `"≠"`, `"≤"`, `"≥"` | Yes | | name | string | Metadata field name to compare against. | Yes | | value | string
[ string ]
number | Value to compare against. Type depends on `comparison_operator`: string for most string operators, array of strings for `in` and `not in`, number for numeric operators, and omit or use `null` for `empty` and `not empty`. | No | #### ConversationInfiniteScrollPagination | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [SimpleConversation](#simpleconversation) ] | | Yes | | has_more | boolean | | Yes | | limit | integer | | Yes | #### ConversationListQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | last_id | string | The ID of the last record on the current page. Used to fetch the next page. | No | | limit | integer,
**Default:** 20 | Number of records to return. | No | | sort_by | string,
**Available values:** "-created_at", "-updated_at", "created_at", "updated_at",
**Default:** -updated_at | Sorting field. Use the `-` prefix for descending order.
*Enum:* `"-created_at"`, `"-updated_at"`, `"created_at"`, `"updated_at"` | No | #### ConversationRenamePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | auto_generate | boolean | Automatically generate the conversation name. When `true`, the `name` field is ignored. | No | | name | string | Conversation name. Required when `auto_generate` is `false`. | No | #### ConversationRenamePayloadWithUser | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | auto_generate | boolean | Automatically generate the conversation name. When `true`, the `name` field is ignored. | No | | name | string | Conversation name. Required when `auto_generate` is `false`. | No | | user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | No | #### ConversationVariableInfiniteScrollPaginationResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [ConversationVariableResponse](#conversationvariableresponse) ] | | Yes | | has_more | boolean | | Yes | | limit | integer | | Yes | #### ConversationVariableResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | created_at | integer | | No | | description | string | | No | | id | string | | Yes | | name | string | | Yes | | updated_at | integer | | No | | value | string | | No | | value_type | string | | Yes | #### ConversationVariableUpdatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | value | | The new value for the variable. Must match the variable's expected type. | Yes | #### ConversationVariableUpdatePayloadWithUser | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | No | | value | | The new value for the variable. Must match the variable's expected type. | Yes | #### ConversationVariablesQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | last_id | string | The ID of the last record on the current page. Used to fetch the next page. | No | | limit | integer,
**Default:** 20 | Number of records to return. | No | | variable_name | string | Filter variables by a specific name. | No | #### CustomConfigurationStatus Enum class for custom configuration status. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | CustomConfigurationStatus | string | Enum class for custom configuration status. | | #### DatasetBoundTagListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [DatasetBoundTagResponse](#datasetboundtagresponse) ] | | Yes | | total | integer | | Yes | #### DatasetBoundTagResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | id | string | | Yes | | name | string | | Yes | #### DatasetCreatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | description | string | Description of the knowledge base. | No | | embedding_model | string | Embedding model name. Use the `model` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No | | embedding_model_provider | string | Embedding model provider. Use the `provider` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No | | external_knowledge_api_id | string | ID of the external knowledge API. | No | | external_knowledge_id | string | ID of the external knowledge base. | No | | indexing_technique | string | `high_quality` uses embedding models for precise search; `economy` uses keyword-based indexing. | No | | name | string | Name of the knowledge base. | Yes | | permission | [PermissionEnum](#permissionenum) | Controls who can access this knowledge base. `only_me` restricts access to the creator, `all_team_members` grants workspace-wide access, and `partial_members` grants access to specified members. | No | | provider | string,
**Available values:** "external", "vendor",
**Default:** vendor | Knowledge base provider: `vendor` for internal knowledge bases, `external` for external ones.
*Enum:* `"external"`, `"vendor"` | No | | retrieval_model | [RetrievalModel](#retrievalmodel) | Retrieval model configuration. Controls how chunks are searched and ranked. | No | | summary_index_setting | object | Summary index configuration. | No | #### DatasetDetailResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | app_count | integer | | Yes | | author_name | string | | Yes | | built_in_field_enabled | boolean | | Yes | | chunk_structure | string | | Yes | | created_at | integer | | Yes | | created_by | string | | Yes | | data_source_type | string | | Yes | | description | string | | Yes | | doc_form | string | | Yes | | doc_metadata | [ [DatasetDocMetadataResponse](#datasetdocmetadataresponse) ] | | Yes | | document_count | integer | | Yes | | embedding_available | boolean | | No | | embedding_model | string | | Yes | | embedding_model_provider | string | | Yes | | enable_api | boolean | | Yes | | external_knowledge_info | [DatasetExternalKnowledgeInfoResponse](#datasetexternalknowledgeinforesponse) | | No | | external_retrieval_model | [DatasetExternalRetrievalModelResponse](#datasetexternalretrievalmodelresponse) | | Yes | | icon_info | [DatasetIconInfoResponse](#dataseticoninforesponse) | | No | | id | string | | Yes | | indexing_technique | string | | Yes | | is_multimodal | boolean | | Yes | | is_published | boolean | | Yes | | maintainer | string | | No | | name | string | | Yes | | permission | string | | Yes | | permission_keys | [ string ] | | No | | pipeline_id | string | | Yes | | provider | string | | Yes | | retrieval_model_dict | [DatasetRetrievalModelResponse](#datasetretrievalmodelresponse) | | Yes | | runtime_mode | string | | Yes | | summary_index_setting | [DatasetSummaryIndexSettingResponse](#datasetsummaryindexsettingresponse) | | No | | tags | [ [DatasetTagResponse](#datasettagresponse) ] | | Yes | | total_available_documents | integer | | Yes | | total_documents | integer | | Yes | | updated_at | integer | | Yes | | updated_by | string | | Yes | | word_count | integer | | Yes | #### DatasetDetailWithPartialMembersResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | app_count | integer | | Yes | | author_name | string | | Yes | | built_in_field_enabled | boolean | | Yes | | chunk_structure | string | | Yes | | created_at | integer | | Yes | | created_by | string | | Yes | | data_source_type | string | | Yes | | description | string | | Yes | | doc_form | string | | Yes | | doc_metadata | [ [DatasetDocMetadataResponse](#datasetdocmetadataresponse) ] | | Yes | | document_count | integer | | Yes | | embedding_available | boolean | | No | | embedding_model | string | | Yes | | embedding_model_provider | string | | Yes | | enable_api | boolean | | Yes | | external_knowledge_info | [DatasetExternalKnowledgeInfoResponse](#datasetexternalknowledgeinforesponse) | | No | | external_retrieval_model | [DatasetExternalRetrievalModelResponse](#datasetexternalretrievalmodelresponse) | | Yes | | icon_info | [DatasetIconInfoResponse](#dataseticoninforesponse) | | No | | id | string | | Yes | | indexing_technique | string | | Yes | | is_multimodal | boolean | | Yes | | is_published | boolean | | Yes | | maintainer | string | | No | | name | string | | Yes | | partial_member_list | [ string ] | | No | | permission | string | | Yes | | permission_keys | [ string ] | | No | | pipeline_id | string | | Yes | | provider | string | | Yes | | retrieval_model_dict | [DatasetRetrievalModelResponse](#datasetretrievalmodelresponse) | | Yes | | runtime_mode | string | | Yes | | summary_index_setting | [DatasetSummaryIndexSettingResponse](#datasetsummaryindexsettingresponse) | | No | | tags | [ [DatasetTagResponse](#datasettagresponse) ] | | Yes | | total_available_documents | integer | | Yes | | total_documents | integer | | Yes | | updated_at | integer | | Yes | | updated_by | string | | Yes | | word_count | integer | | Yes | #### DatasetDocMetadataResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | id | string | | Yes | | name | string | | Yes | | type | string | | Yes | #### DatasetExternalKnowledgeInfoResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | external_knowledge_api_endpoint | string | | No | | external_knowledge_api_id | string | | No | | external_knowledge_api_name | string | | No | | external_knowledge_id | string | | No | #### DatasetExternalRetrievalModelResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | score_threshold | number | | No | | score_threshold_enabled | boolean | | No | | top_k | integer | | Yes | #### DatasetIconInfoResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | icon | string | | No | | icon_background | string | | No | | icon_type | string | | No | | icon_url | string | | No | #### DatasetKeywordSettingResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | keyword_weight | number | | No | #### DatasetListQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | include_all | boolean | Whether to include all knowledge bases regardless of permissions. | No | | keyword | string | Search keyword to filter by name. | No | | limit | integer,
**Default:** 20 | Number of items per page. Server caps at `100`. | No | | page | integer,
**Default:** 1 | Page number to retrieve. | No | | tag_ids | [ string ] | Tag IDs to filter by. | No | #### DatasetListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [DatasetDetailResponse](#datasetdetailresponse) ] | | Yes | | has_more | boolean | | Yes | | limit | integer | | Yes | | page | integer | | Yes | | total | integer | | Yes | #### DatasetMetadataActionResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | result | string | | Yes | #### DatasetMetadataBuiltInFieldResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | name | string | | Yes | | type | string | | Yes | #### DatasetMetadataBuiltInFieldsResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | fields | [ [DatasetMetadataBuiltInFieldResponse](#datasetmetadatabuiltinfieldresponse) ] | | Yes | #### DatasetMetadataListItemResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | count | integer | | No | | id | string | | Yes | | name | string | | Yes | | type | string | | Yes | #### DatasetMetadataListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | built_in_field_enabled | boolean | | Yes | | doc_metadata | [ [DatasetMetadataListItemResponse](#datasetmetadatalistitemresponse) ] | | Yes | #### DatasetMetadataResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | id | string | | Yes | | name | string | | Yes | | type | string | | Yes | #### DatasetRerankingModelResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | reranking_model_name | string | | No | | reranking_provider_name | string | | No | #### DatasetRetrievalModelResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | reranking_enable | boolean | | Yes | | reranking_mode | string | | No | | reranking_model | [DatasetRerankingModelResponse](#datasetrerankingmodelresponse) | | No | | score_threshold | number | | No | | score_threshold_enabled | boolean | | Yes | | search_method | string | | Yes | | top_k | integer | | Yes | | weights | [DatasetWeightedScoreResponse](#datasetweightedscoreresponse) | | No | #### DatasetSummaryIndexSettingResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | enable | boolean | | No | | model_name | string | | No | | model_provider_name | string | | No | | summary_prompt | string | | No | #### DatasetTagResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | id | string | | Yes | | name | string | | Yes | | type | string | | Yes | #### DatasetUpdatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | description | string | Description of the knowledge base. | No | | embedding_model | string | Embedding model name. Use the `model` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No | | embedding_model_provider | string | Embedding model provider. Use the `provider` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No | | external_knowledge_api_id | string | ID of the external knowledge API. | No | | external_knowledge_id | string | ID of the external knowledge base. | No | | external_retrieval_model | object | Retrieval settings for external knowledge bases. | No | | indexing_technique | string | `high_quality` uses embedding models for precise search; `economy` uses keyword-based indexing. | No | | name | string | Name of the knowledge base. | No | | partial_member_list | [ object ] | List of team members with access when `permission` is `partial_members`. | No | | permission | [PermissionEnum](#permissionenum) | Controls who can access this knowledge base. `only_me` restricts access to the creator, `all_team_members` grants workspace-wide access, and `partial_members` grants access to specified members. | No | | retrieval_model | [RetrievalModel](#retrievalmodel) | Retrieval model configuration. Controls how chunks are searched and ranked. | No | #### DatasetVectorSettingResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | embedding_model_name | string | | No | | embedding_provider_name | string | | No | | vector_weight | number | | No | #### DatasetWeightedScoreResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | keyword_setting | [DatasetKeywordSettingResponse](#datasetkeywordsettingresponse) | | No | | vector_setting | [DatasetVectorSettingResponse](#datasetvectorsettingresponse) | | No | | weight_type | string | | No | #### DatasourceCredentialInfoResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | id | string | | No | | is_default | boolean | | No | | name | string | | No | | type | string | | No | #### DatasourceNodeRunPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | credential_id | string | Datasource credential ID. Uses the default if omitted. | No | | datasource_type | string,
**Available values:** "local_file", "online_document", "online_drive", "website_crawl" | Type of the datasource.
*Enum:* `"local_file"`, `"online_document"`, `"online_drive"`, `"website_crawl"` | Yes | | inputs | object | Input variables for the datasource node. | Yes | | is_published | boolean | Whether to run the published or draft version of the node. `true` runs the published version, `false` runs the draft. | Yes | #### DatasourcePluginListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | DatasourcePluginListResponse | array | | | #### DatasourcePluginResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | credentials | [ [DatasourceCredentialInfoResponse](#datasourcecredentialinforesponse) ] | | No | | datasource_type | string | | No | | node_id | string | | No | | plugin_id | string | | No | | provider_name | string | | No | | title | string | | No | | user_input_variables | [ object ] | | No | #### DatasourcePluginsQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | is_published | boolean,
**Default:** true | Whether to retrieve nodes from the published or draft pipeline. `true` returns nodes from the published version, `false` returns nodes from the draft. | No | #### DocumentAndBatchResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | batch | string | | Yes | | document | [DocumentResponse](#documentresponse) | | Yes | #### DocumentBatchDownloadZipPayload Request payload for bulk downloading documents as a zip archive. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | document_ids | [ string (uuid) ] | List of document IDs to include in the ZIP download. | Yes | #### DocumentDetailResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | archived | boolean | | No | | average_segment_length | integer
number | | No | | completed_at | integer | | No | | created_at | integer | | No | | created_by | string | | No | | created_from | string | | No | | data_source_info | object | | No | | data_source_type | string | | No | | dataset_process_rule | object | | No | | dataset_process_rule_id | string | | No | | disabled_at | integer | | No | | disabled_by | string | | No | | display_status | string | | No | | doc_form | string | | No | | doc_language | string | | No | | doc_metadata | [ [DocumentMetadataResponse](#documentmetadataresponse) ]
object | | No | | doc_type | string | | No | | document_process_rule | object | | No | | enabled | boolean | | No | | error | string | | No | | hit_count | integer | | No | | id | string | | Yes | | indexing_latency | number | | No | | indexing_status | string | | No | | name | string | | No | | need_summary | boolean | | No | | position | integer | | No | | segment_count | integer | | No | | summary_index_status | string | | No | | tokens | integer | | No | | updated_at | integer | | No | #### DocumentGetQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | metadata | string,
**Available values:** "all", "only", "without",
**Default:** all | `all` returns all fields including metadata. `only` returns only `id`, `doc_type`, and `doc_metadata`. `without` returns all fields except `doc_metadata`.
*Enum:* `"all"`, `"only"`, `"without"` | No | #### DocumentListQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | keyword | string | Search keyword to filter by document name. | No | | limit | integer,
**Default:** 20 | Number of items per page. Server caps at `100`. | No | | page | integer,
**Default:** 1 | Page number to retrieve. | No | | status | string | Filter by display status. | No | #### DocumentListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [DocumentResponse](#documentresponse) ] | | Yes | | has_more | boolean | | Yes | | limit | integer | | Yes | | page | integer | | Yes | | total | integer | | Yes | #### DocumentMetadataOperation | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | document_id | string (uuid) | Document ID whose metadata should be updated. | Yes | | metadata_list | [ [MetadataDetail](#metadatadetail) ] | Metadata fields to update. | Yes | | partial_update | boolean | Whether to partially update metadata, keeping existing values for unspecified fields. | No | #### DocumentMetadataResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | id | string | | Yes | | name | string | | Yes | | type | string | | Yes | | value | string
integer
number
boolean | | No | #### DocumentResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | archived | boolean | | No | | created_at | integer | | No | | created_by | string | | No | | created_from | string | | No | | data_source_detail_dict | | | No | | data_source_info | | | No | | data_source_type | string | | No | | dataset_process_rule_id | string | | No | | disabled_at | integer | | No | | disabled_by | string | | No | | display_status | string | | No | | doc_form | string | | No | | doc_metadata | [ [DocumentMetadataResponse](#documentmetadataresponse) ] | | No | | enabled | boolean | | No | | error | string | | No | | hit_count | integer | | No | | id | string | | Yes | | indexing_status | string | | No | | name | string | | Yes | | need_summary | boolean | | No | | position | integer | | No | | summary_index_status | string | | No | | tokens | integer | | No | | word_count | integer | | No | #### DocumentStatusListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [DocumentStatusResponse](#documentstatusresponse) ] | | Yes | #### DocumentStatusPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | document_ids | [ string ] | List of document IDs to update. | No | #### DocumentStatusResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | cleaning_completed_at | integer | | Yes | | completed_at | integer | | Yes | | completed_segments | integer | | No | | error | string | | Yes | | error_code | string | | No | | estimated_vector_space_mb | integer | | No | | id | string | | Yes | | indexing_status | string | | Yes | | parsing_completed_at | integer | | Yes | | paused_at | integer | | Yes | | processing_started_at | integer | | Yes | | splitting_completed_at | integer | | Yes | | stopped_at | integer | | Yes | | total_segments | integer | | No | | vector_space_limit_mb | integer | | No | #### DocumentTextCreatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | doc_form | string,
**Available values:** "hierarchical_model", "qa_model", "text_model",
**Default:** text_model | `text_model` for standard text chunking, `hierarchical_model` for parent-child chunk structure, `qa_model` for question-answer pair extraction.
*Enum:* `"hierarchical_model"`, `"qa_model"`, `"text_model"` | No | | doc_language | string,
**Default:** English | Language of the document for processing optimization. | No | | embedding_model | string | Embedding model name. Use the `model` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No | | embedding_model_provider | string | Embedding model provider. Use the `provider` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No | | indexing_technique | string | `high_quality` uses embedding models for precise search; `economy` uses keyword-based indexing. Required when adding the first document to a knowledge base; subsequent documents inherit the knowledge base's indexing technique if omitted. | No | | name | string | Document name. | Yes | | original_document_id | string | Original document ID for replacement. | No | | process_rule | [ProcessRule](#processrule) | Processing rules for chunking. | No | | retrieval_model | [RetrievalModel](#retrievalmodel) | Retrieval model configuration. Controls how chunks are searched and ranked. | No | | text | string | Document text content. | Yes | #### DocumentTextUpdate | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | doc_form | string,
**Available values:** "hierarchical_model", "qa_model", "text_model",
**Default:** text_model | `text_model` for standard text chunking, `hierarchical_model` for parent-child chunk structure, `qa_model` for question-answer pair extraction.
*Enum:* `"hierarchical_model"`, `"qa_model"`, `"text_model"` | No | | doc_language | string,
**Default:** English | Language of the document for processing optimization. | No | | name | string | Document name. Required when `text` is provided. | No | | process_rule | [ProcessRule](#processrule) | Processing rules for chunking. | No | | retrieval_model | [RetrievalModel](#retrievalmodel) | Retrieval model configuration. Controls how chunks are searched and ranked. | No | | text | string | Document text content. | No | #### EndUserDetail Full EndUser record for API responses. Note: The SQLAlchemy model defines an `is_anonymous` property for Flask-Login semantics (always False). The database column is exposed as `_is_anonymous`, so this DTO maps `is_anonymous` from `_is_anonymous` to return the stored value. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | app_id | string | | No | | created_at | dateTime | | Yes | | external_user_id | string | | No | | id | string | | Yes | | is_anonymous | boolean | | Yes | | name | string | | No | | session_id | string | | Yes | | tenant_id | string | | Yes | | type | string | | Yes | | updated_at | dateTime | | Yes | #### EventStreamResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | EventStreamResponse | string | | | #### ExecutionContentType | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | ExecutionContentType | string | | | #### FeedbackListQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | limit | integer,
**Default:** 20 | Number of records per page. | No | | page | integer,
**Default:** 1 | Page number for pagination. | No | #### FetchFrom Enum class for fetch from. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | FetchFrom | string | Enum class for fetch from. | | #### FileInputConfig | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | allowed_file_extensions | [ string ] | | No | | allowed_file_types | [ [FileType](#filetype) ] | | No | | allowed_file_upload_methods | [ [FileTransferMethod](#filetransfermethod) ] | | No | | output_variable_name | string | | Yes | | type | string | | No | #### FileListInputConfig | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | allowed_file_extensions | [ string ] | | No | | allowed_file_types | [ [FileType](#filetype) ] | | No | | allowed_file_upload_methods | [ [FileTransferMethod](#filetransfermethod) ] | | No | | number_limits | integer | | No | | output_variable_name | string | | Yes | | type | string | | No | #### FilePreviewQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | as_attachment | boolean | If `true`, forces the file to download as an attachment instead of previewing in browser. | No | #### FileResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | conversation_id | string | | No | | created_at | integer | | No | | created_by | string | | No | | extension | string | | No | | file_key | string | | No | | id | string | | Yes | | mime_type | string | | No | | name | string | | Yes | | original_url | string | | No | | preview_url | string | | No | | reference | string | | No | | size | integer | | Yes | | source_url | string | | No | | tenant_id | string | | No | | user_id | string | | No | #### FileTransferMethod | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | FileTransferMethod | string | | | #### FileType | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | FileType | string | | | #### FormInputConfig | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | FormInputConfig | [ParagraphInputConfig](#paragraphinputconfig)
[SelectInputConfig](#selectinputconfig)
[FileInputConfig](#fileinputconfig)
[FileListInputConfig](#filelistinputconfig) | | | #### GeneratedAppResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | GeneratedAppResponse | | | | #### HitTestingChildChunk | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | content | string | | Yes | | id | string | | Yes | | position | integer | | Yes | | score | number | | Yes | #### HitTestingDocument | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data_source_type | string | | Yes | | doc_metadata | | | Yes | | doc_type | string | | Yes | | id | string | | Yes | | name | string | | Yes | #### HitTestingFile | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | extension | string | | Yes | | id | string | | Yes | | mime_type | string | | Yes | | name | string | | Yes | | size | integer | | Yes | | source_url | string | | Yes | #### HitTestingPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | attachment_ids | [ string ] | List of attachment IDs to include in the retrieval context. | No | | external_retrieval_model | object | Retrieval settings for external knowledge bases. | No | | query | string | Search query text. | Yes | | retrieval_model | [RetrievalModel](#retrievalmodel) | Retrieval model configuration. Controls how chunks are searched and ranked. | No | #### HitTestingQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | content | string | | Yes | #### HitTestingRecord | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | child_chunks | [ [HitTestingChildChunk](#hittestingchildchunk) ] | | Yes | | files | [ [HitTestingFile](#hittestingfile) ] | | Yes | | score | number | | Yes | | segment | [HitTestingSegment](#hittestingsegment) | | Yes | | summary | string | | Yes | | tsne_position | | | Yes | #### HitTestingResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | query | [HitTestingQuery](#hittestingquery) | | Yes | | records | [ [HitTestingRecord](#hittestingrecord) ] | | Yes | #### HitTestingSegment | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | answer | string | | Yes | | completed_at | integer | | Yes | | content | string | | Yes | | created_at | integer | | Yes | | created_by | string | | Yes | | disabled_at | integer | | Yes | | disabled_by | string | | Yes | | document | [HitTestingDocument](#hittestingdocument) | | Yes | | document_id | string | | Yes | | enabled | boolean | | Yes | | error | string | | Yes | | hit_count | integer | | Yes | | id | string | | Yes | | index_node_hash | string | | Yes | | index_node_id | string | | Yes | | indexing_at | integer | | Yes | | keywords | [ string ] | | Yes | | position | integer | | Yes | | sign_content | string | | Yes | | status | string | | Yes | | stopped_at | integer | | Yes | | tokens | integer | | Yes | | word_count | integer | | Yes | #### HumanInputContent | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | form_definition | [HumanInputFormDefinition](#humaninputformdefinition) | | No | | form_submission_data | [HumanInputFormSubmissionData](#humaninputformsubmissiondata) | | No | | submitted | boolean | | Yes | | type | [ExecutionContentType](#executioncontenttype) | | No | | workflow_run_id | string | | Yes | #### HumanInputFormDefinition | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | actions | [ [UserActionConfig](#useractionconfig) ] | | No | | display_in_ui | boolean | | No | | expiration_time | integer | | Yes | | form_content | string | | Yes | | form_id | string | | Yes | | form_token | string | | No | | inputs | [ [FormInputConfig](#forminputconfig) ] | | No | | node_id | string | | Yes | | node_title | string | | Yes | | resolved_default_values | object | | No | #### HumanInputFormDefinitionResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | expiration_time | integer | | No | | form_content | string | | Yes | | inputs | [ object ] | | No | | resolved_default_values | object | | Yes | | user_actions | [ object ] | | No | #### HumanInputFormSubmissionData | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | action_id | string | | Yes | | action_text | string | | Yes | | node_id | string | | Yes | | node_title | string | | Yes | | rendered_content | string | | Yes | | submitted_data | object | | No | #### HumanInputFormSubmitPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | action | string | ID of the action button the recipient selected. Must match one of the `id` values from the form's `user_actions` list. | Yes | | inputs | object | Submitted human input values keyed by output variable name. Use a string for paragraph or select input values, a file mapping for file inputs, and a list of file mappings for file-list inputs. Local file mappings use `transfer_method=local_file` with `upload_file_id`; remote file mappings use `transfer_method=remote_url` with `url` or `remote_url`. | Yes | #### HumanInputFormSubmitPayloadWithUser | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | action | string | ID of the action button the recipient selected. Must match one of the `id` values from the form's `user_actions` list. | Yes | | inputs | object | Submitted human input values keyed by output variable name. Use a string for paragraph or select input values, a file mapping for file inputs, and a list of file mappings for file-list inputs. Local file mappings use `transfer_method=local_file` with `upload_file_id`; remote file mappings use `transfer_method=remote_url` with `url` or `remote_url`. | Yes | | user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | Yes | #### HumanInputFormSubmitResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | #### I18nObject Model class for i18n object. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | en_US | string | | Yes | | zh_Hans | string | | No | #### IndexInfoResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | api_version | string | | Yes | | server_version | string | | Yes | | welcome | string | | Yes | #### JSONObject | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | JSONObject | object | | | #### JSONValue | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | JSONValue | string
integer
number
boolean
object
[ object ] | | | #### JSONValueType | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | JSONValueType | | | | #### JsonValue | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | JsonValue | | | | #### KnowledgeFSAdmittedQueryRequest | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | activeDocumentIds | [ string ] | | No | | activeEntityIds | [ string ] | | No | | knowledgeSpaceId | string | | Yes | | mode | string | | No | | query | string | | No | | queryImages | [ [KnowledgeFSQueryImageReference](#knowledgefsqueryimagereference) ] | | No | | sessionId | string | | No | #### KnowledgeFSAnswerTraceResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | created_at | dateTime | | Yes | | evidence_bundle_id | string | | No | | id | string | | Yes | | knowledge_space_id | string | | Yes | | mode | string,
**Available values:** "auto", "deep", "fast", "research" | *Enum:* `"auto"`, `"deep"`, `"fast"`, `"research"` | Yes | | query | string | | Yes | | steps | [ [KnowledgeFSAnswerTraceStepResponse](#knowledgefsanswertracestepresponse) ] | | Yes | #### KnowledgeFSAnswerTraceStepResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | ended_at | string | | No | | metadata | object | | Yes | | name | string | | Yes | | started_at | dateTime | | Yes | | status | string,
**Available values:** "error", "ok", "skipped" | *Enum:* `"error"`, `"ok"`, `"skipped"` | Yes | #### KnowledgeFSBulkDeletionAcceptedItemResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | document_id | string | | Yes | | document_title | string | | No | | job | [KnowledgeFSDurableDeletionJobResponse](#knowledgefsdurabledeletionjobresponse) | | Yes | | status_url | string | | Yes | #### KnowledgeFSBulkDeletionAcceptedResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | items | [ [KnowledgeFSBulkDeletionAcceptedItemResponse](#knowledgefsbulkdeletionaccepteditemresponse) ] | | Yes | | total | integer | | Yes | #### KnowledgeFSBulkDocumentDeleteItemPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | documentId | string | | Yes | | expectedRevision | integer | | Yes | #### KnowledgeFSBulkDocumentDeletePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | documents | [ [KnowledgeFSBulkDocumentDeleteItemPayload](#knowledgefsbulkdocumentdeleteitempayload) ] | | Yes | #### KnowledgeFSBulkJobResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | canceled_items | integer | | Yes | | completed_items | integer | | Yes | | created_at | dateTime | | Yes | | failed_item_ids | [ string ] | | Yes | | failed_items | integer | | Yes | | id | string | | Yes | | knowledge_space_id | string | | Yes | | status | string,
**Available values:** "canceled", "completed", "failed", "running" | *Enum:* `"canceled"`, `"completed"`, `"failed"`, `"running"` | Yes | | total_items | integer | | Yes | | type | string,
**Available values:** "document_delete", "document_reindex", "document_upload" | *Enum:* `"document_delete"`, `"document_reindex"`, `"document_upload"` | Yes | | updated_at | dateTime | | Yes | #### KnowledgeFSCrawledPageResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | content | string | | Yes | | description | string | | No | | source_url | string | | Yes | | title | string | | No | #### KnowledgeFSCursorQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | cursor | string | | No | #### KnowledgeFSDocumentChunkListQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | cursor | string | | No | | query | string | | No | #### KnowledgeFSDocumentChunkListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [KnowledgeFSDocumentChunkResponse](#knowledgefsdocumentchunkresponse) ] | | Yes | | next_cursor | string | | No | #### KnowledgeFSDocumentChunkResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | created_at | dateTime | | Yes | | document_id | string | | Yes | | document_revision | integer | | Yes | | enabled | boolean | | Yes | | id | string | | Yes | | kind | string,
**Available values:** "chunk", "image", "section", "summary", "table",
**Default:** chunk | *Enum:* `"chunk"`, `"image"`, `"section"`, `"summary"`, `"table"` | No | | knowledge_space_id | string | | Yes | | ordinal | integer | | Yes | | parent_chunk_id | string | | No | | section_path | [ string ] | | No | | text | string | | Yes | | token_count | integer | | Yes | | user_metadata | object | | Yes | #### KnowledgeFSDocumentCompilationJobResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | base_head_revision | integer | | No | | candidate_fingerprint | string | | No | | candidate_publication_id | string | | No | | completed_at | number | | No | | created_at | number | | Yes | | document_asset_id | string | | Yes | | error | string | | No | | execution_attempts | integer | | No | | id | string | | Yes | | knowledge_space_id | string | | Yes | | max_execution_attempts | integer | | No | | run_state | string | | No | | stage | string,
**Available values:** "canceled", "failed", "nodes_generated", "outline_built", "parsed", "projection_built", "published", "queued", "smoke_eval_passed" | *Enum:* `"canceled"`, `"failed"`, `"nodes_generated"`, `"outline_built"`, `"parsed"`, `"projection_built"`, `"published"`, `"queued"`, `"smoke_eval_passed"` | Yes | | updated_at | number | | Yes | | version | integer | | Yes | #### KnowledgeFSDocumentCreatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | idempotency_key | string | | Yes | | name | string | | Yes | | text | string | | Yes | #### KnowledgeFSDocumentDeletePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | expectedRevision | integer | | Yes | #### KnowledgeFSDocumentListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [KnowledgeFSDocumentResponse](#knowledgefsdocumentresponse) ] | | Yes | | next_cursor | string | | No | #### KnowledgeFSDocumentMetadataPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | expectedRowVersion | integer | | Yes | | patch | object | | Yes | #### KnowledgeFSDocumentOutlineNodeResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | child_node_ids | [ string ] | | No | | children | [ [KnowledgeFSDocumentOutlineNodeResponse](#knowledgefsdocumentoutlinenoderesponse) ] | | No | | end_offset | integer | | No | | end_page | integer | | No | | id | string | | Yes | | level | integer | | Yes | | metadata | object | | Yes | | section_path | [ string ] | | No | | source_element_ids | [ string ] | | No | | source_node_ids | [ string ] | | No | | start_offset | integer | | No | | start_page | integer | | No | | summary | string | | No | | title | string | | Yes | | title_location | object | | No | | toc_source | string | | Yes | #### KnowledgeFSDocumentOutlineResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | artifact_hash | string | | Yes | | created_at | dateTime | | Yes | | document_asset_id | string | | Yes | | id | string | | Yes | | knowledge_space_id | string | | Yes | | metadata | object | | Yes | | nodes | [ [KnowledgeFSDocumentOutlineNodeResponse](#knowledgefsdocumentoutlinenoderesponse) ] | | Yes | | outline_version | string | | Yes | | parse_artifact_id | string | | Yes | | updated_at | string | | No | | version | integer | | Yes | #### KnowledgeFSDocumentReindexItemResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | asset | [KnowledgeFSDocumentResponse](#knowledgefsdocumentresponse) | | No | | compilation_job | object | | No | | document_id | string | | No | | status | string,
**Available values:** "disabled", "not_found", "queued" | *Enum:* `"disabled"`, `"not_found"`, `"queued"` | Yes | | status_url | string | | No | #### KnowledgeFSDocumentReindexPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | all | boolean | | No | | documentIds | [ string ] | | No | #### KnowledgeFSDocumentReindexResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | bulk_job_id | string | | Yes | | items | [ [KnowledgeFSDocumentReindexItemResponse](#knowledgefsdocumentreindexitemresponse) ] | | Yes | | total | integer | | Yes | #### KnowledgeFSDocumentResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | created_at | dateTime | | Yes | | filename | string | | Yes | | id | string | | Yes | | knowledge_space_id | string | | Yes | | metadata | object | | Yes | | mime_type | string | | Yes | | object_key | string | | Yes | | parser_status | string,
**Available values:** "failed", "parsed", "pending" | *Enum:* `"failed"`, `"parsed"`, `"pending"` | Yes | | sha256 | string | | Yes | | size_bytes | integer | | Yes | | source_id | string | | No | | updated_at | string | | No | | version | integer | | Yes | #### KnowledgeFSDocumentRevisionListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [KnowledgeFSDocumentRevisionResponse](#knowledgefsdocumentrevisionresponse) ] | | Yes | | next_cursor | string | | No | #### KnowledgeFSDocumentRevisionResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | activated_at | string | | No | | content_hash | string | | Yes | | created_at | dateTime | | Yes | | document_asset_id | string | | Yes | | document_asset_version | integer | | Yes | | document_id | string | | Yes | | knowledge_space_id | string | | Yes | | mime_type | string | | Yes | | revision | integer | | Yes | | size_bytes | integer | | Yes | | state | string,
**Available values:** "active", "candidate", "failed", "superseded" | *Enum:* `"active"`, `"candidate"`, `"failed"`, `"superseded"` | Yes | #### KnowledgeFSDurableDeletionAcceptedResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | job | [KnowledgeFSDurableDeletionJobResponse](#knowledgefsdurabledeletionjobresponse) | | Yes | | status_url | string | | Yes | #### KnowledgeFSDurableDeletionErrorResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | code | string | | Yes | | message | string | | Yes | | retryable | boolean | | Yes | #### KnowledgeFSDurableDeletionJobResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | checkpoint | string,
**Available values:** "completed", "deleting_derived_data", "deleting_objects", "deleting_primary_data", "quiescing", "requested" | *Enum:* `"completed"`, `"deleting_derived_data"`, `"deleting_objects"`, `"deleting_primary_data"`, `"quiescing"`, `"requested"` | Yes | | completed_at | string | | No | | created_at | dateTime | | Yes | | error | [KnowledgeFSDurableDeletionErrorResponse](#knowledgefsdurabledeletionerrorresponse) | | No | | id | string | | Yes | | knowledge_space_id | string | | Yes | | mode | string | | No | | progress | [KnowledgeFSDurableDeletionProgressResponse](#knowledgefsdurabledeletionprogressresponse) | | No | | retry_at | string | | No | | run_state | string,
**Available values:** "canceled", "completed", "dispatch_pending", "failed", "queued", "retry_wait", "running" | *Enum:* `"canceled"`, `"completed"`, `"dispatch_pending"`, `"failed"`, `"queued"`, `"retry_wait"`, `"running"` | Yes | | target_id | string | | Yes | | target_type | string,
**Available values:** "document", "knowledge_space", "logical_document", "source" | *Enum:* `"document"`, `"knowledge_space"`, `"logical_document"`, `"source"` | Yes | | updated_at | dateTime | | Yes | #### KnowledgeFSDurableDeletionProgressResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | completed_items | integer | | Yes | | current_item_kind | string | | No | | total_items | integer | | No | #### KnowledgeFSEmbeddingSettingsResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | dimension | integer | | No | | model | string | | Yes | | plugin_id | string | | Yes | | provider | string | | Yes | | revision | integer | | No | | vector_space_id | string | | No | #### KnowledgeFSLogicalDocumentResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | active | [KnowledgeFSDocumentRevisionResponse](#knowledgefsdocumentrevisionresponse) | | Yes | | active_revision | integer | | No | | created_at | dateTime | | Yes | | disabled_at | string | | No | | disabled_by_subject_id | string | | No | | enabled | boolean,
**Default:** true | | No | | id | string | | Yes | | knowledge_space_id | string | | Yes | | provider_item_id | string | | No | | row_version | integer | | Yes | | source_id | string | | No | | status | string,
**Available values:** "deleting", "failed", "pending", "ready" | *Enum:* `"deleting"`, `"failed"`, `"pending"`, `"ready"` | Yes | | title | string | | Yes | | updated_at | dateTime | | Yes | | user_metadata | object | | Yes | #### KnowledgeFSProductRerankProfile | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | enabled | boolean | | Yes | | model | [KnowledgeFSProfileModelSelection](#knowledgefsprofilemodelselection) | | No | #### KnowledgeFSProductRetrievalProfile | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | defaultMode | string,
**Available values:** "deep", "fast", "research" | *Enum:* `"deep"`, `"fast"`, `"research"` | Yes | | reasoningModel | [KnowledgeFSProfileModelSelection](#knowledgefsprofilemodelselection) | | Yes | | rerank | [KnowledgeFSProductRerankProfile](#knowledgefsproductrerankprofile) | | Yes | | scoreThreshold | [KnowledgeFSProductScoreThreshold](#knowledgefsproductscorethreshold) | | Yes | | topK | integer | | Yes | #### KnowledgeFSProductScoreThreshold | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | enabled | boolean | | Yes | | stage | string,
**Available values:** "mode-final", "rerank",
**Default:** mode-final | *Enum:* `"mode-final"`, `"rerank"` | No | | value | number | | No | #### KnowledgeFSProfileModelSelection | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | model | string | | Yes | | pluginId | string | | Yes | | provider | string | | Yes | #### KnowledgeFSQueryAdmissionResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | expires_at | dateTime | | Yes | | operation_id | string | | Yes | | request | [KnowledgeFSAdmittedQueryRequest](#knowledgefsadmittedqueryrequest) | | Yes | | token | string | | Yes | | url | string | | Yes | #### KnowledgeFSQueryCreatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | activeDocumentIds | [ string ] | | No | | activeEntityIds | [ string ] | | No | | mode | string | | No | | query | string | | No | | queryImages | [ [KnowledgeFSQueryImageReference](#knowledgefsqueryimagereference) ] | | No | | sessionId | string | | No | #### KnowledgeFSQueryImageReference | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | uploadFileId | string | | Yes | #### KnowledgeFSQueryResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | answer | string | | No | | id | string | | Yes | | status | string | | Yes | | trace_id | string | | No | #### KnowledgeFSResearchTaskCreatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | budgetUsd | number | | No | | limits | [KnowledgeFSResearchTaskLimits](#knowledgefsresearchtasklimits) | | No | | metadata | object | | No | | mode | string | | No | | query | string | | No | | queryImages | [ [KnowledgeFSQueryImageReference](#knowledgefsqueryimagereference) ] | | No | | topK | integer | | No | #### KnowledgeFSResearchTaskLimits | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | maxRetrievalSteps | integer | | No | | maxScannedResources | integer | | No | | maxToolCalls | integer | | No | | timeoutMs | integer | | No | #### KnowledgeFSResearchTaskListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse) ] | | Yes | | next_cursor | string | | No | #### KnowledgeFSResearchTaskPartialListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [KnowledgeFSResearchTaskPartialResponse](#knowledgefsresearchtaskpartialresponse) ] | | Yes | | next_cursor | string | | No | #### KnowledgeFSResearchTaskPartialResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | answer | string | | No | | evidence_bundle | object | | Yes | | knowledge_space_id | string | | Yes | | research_task_job_id | string | | Yes | | sequence | integer | | Yes | #### KnowledgeFSResearchTaskPartialsQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | cursor | string | | No | | limit | integer,
**Default:** 25 | | No | #### KnowledgeFSResearchTaskPlanBudgetResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | budget_usd | number | | No | | exceeds_budget | boolean | | Yes | | remaining_budget_usd | number | | No | #### KnowledgeFSResearchTaskPlanPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | budgetUsd | number | | No | | mode | string | | No | | query | string | | No | | queryImages | [ [KnowledgeFSQueryImageReference](#knowledgefsqueryimagereference) ] | | No | | topK | integer | | No | #### KnowledgeFSResearchTaskPlanResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | budget | [KnowledgeFSResearchTaskPlanBudgetResponse](#knowledgefsresearchtaskplanbudgetresponse) | | Yes | | estimates | object | | Yes | | knowledge_space_id | string | | Yes | | query | string | | Yes | | query_images | [ [KnowledgeFSQueryImageReference](#knowledgefsqueryimagereference) ] | | No | | retrieval_plan | [KnowledgeFSResearchTaskRetrievalPlanResponse](#knowledgefsresearchtaskretrievalplanresponse) | | Yes | | steps | [ object ] | | Yes | | strategy_version | string | | Yes | #### KnowledgeFSResearchTaskResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | budget_usd | number | | No | | completed_at | number | | No | | cost | object | | Yes | | created_at | number | | Yes | | error | string | | No | | id | string | | Yes | | knowledge_space_id | string | | Yes | | limits | [KnowledgeFSResearchTaskLimits](#knowledgefsresearchtasklimits) | | No | | metadata | object | | Yes | | mode | string | | No | | query | string | | Yes | | query_images | [ [KnowledgeFSQueryImageReference](#knowledgefsqueryimagereference) ] | | No | | stage | string,
**Available values:** "analyzing", "canceled", "completed", "failed", "generating", "paused", "planning", "queued", "retrieving" | *Enum:* `"analyzing"`, `"canceled"`, `"completed"`, `"failed"`, `"generating"`, `"paused"`, `"planning"`, `"queued"`, `"retrieving"` | Yes | | top_k | integer | | No | | updated_at | number | | Yes | #### KnowledgeFSResearchTaskRetrievalPlanResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | dense_top_k | integer | | Yes | | fts_top_k | integer | | Yes | | fusion_limit | integer | | Yes | | query_language | string,
**Available values:** "cjk", "latin", "mixed-cjk-latin", "other" | *Enum:* `"cjk"`, `"latin"`, `"mixed-cjk-latin"`, `"other"` | Yes | | requested_mode | string,
**Available values:** "auto", "deep", "fast", "research" | *Enum:* `"auto"`, `"deep"`, `"fast"`, `"research"` | Yes | | rerank_candidate_limit | integer | | Yes | | resolved_mode | string,
**Available values:** "deep", "fast", "research" | *Enum:* `"deep"`, `"fast"`, `"research"` | Yes | | strategy_version | string | | Yes | | top_k | integer | | Yes | #### KnowledgeFSRetrievalSettingsResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | default_mode | string,
**Available values:** "deep", "fast", "research" | *Enum:* `"deep"`, `"fast"`, `"research"` | Yes | | reasoning_model | [KnowledgeFSEmbeddingSettingsResponse](#knowledgefsembeddingsettingsresponse) | | Yes | | rerank | [KnowledgeFSProductRerankProfile](#knowledgefsproductrerankprofile) | | Yes | | revision | integer | | No | | score_threshold | [KnowledgeFSProductScoreThreshold](#knowledgefsproductscorethreshold) | | Yes | | top_k | integer | | Yes | #### KnowledgeFSSettingsPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | embedding | [KnowledgeFSProfileModelSelection](#knowledgefsprofilemodelselection) | | No | | expectedRevision | integer | | Yes | | retrieval | [KnowledgeFSProductRetrievalProfile](#knowledgefsproductretrievalprofile) | | No | #### KnowledgeFSSettingsResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | configuration_state | string,
**Available values:** "active", "pending-validation", "setup-required", "validation-failed" | *Enum:* `"active"`, `"pending-validation"`, `"setup-required"`, `"validation-failed"` | Yes | | embedding | [KnowledgeFSEmbeddingSettingsResponse](#knowledgefsembeddingsettingsresponse) | | Yes | | retrieval | [KnowledgeFSRetrievalSettingsResponse](#knowledgefsretrievalsettingsresponse) | | Yes | | revision | integer | | Yes | #### KnowledgeFSSourceCrawlResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | completed | integer | | No | | failed | integer | | No | | imported | integer | | No | | pages | [ [KnowledgeFSCrawledPageResponse](#knowledgefscrawledpageresponse) ] | | Yes | | replaced | integer | | No | | skipped | integer | | No | | status | string | | No | | total | integer | | No | #### KnowledgeFSSourceCreatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | connectionId | string | | No | | credentials | object | | No | | metadata | object | | No | | name | string | | Yes | | permissionScope | [ string ] | | No | | status | string | | No | | type | string,
**Available values:** "connector", "object-storage", "upload", "web" | *Enum:* `"connector"`, `"object-storage"`, `"upload"`, `"web"` | Yes | | uri | string | | Yes | #### KnowledgeFSSourceCredentialTestResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | code | string | | No | | error | string | | No | | valid | boolean | | Yes | #### KnowledgeFSSourceDeletePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | expectedRevision | integer | | Yes | #### KnowledgeFSSourceDeleteQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | documents | string,
**Available values:** "cascade", "keep",
**Default:** cascade | *Enum:* `"cascade"`, `"keep"` | No | #### KnowledgeFSSourceFileBucketResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | bucket | string | | No | | continuation_token | string | | No | | files | [ [KnowledgeFSSourceFileResponse](#knowledgefssourcefileresponse) ] | | Yes | | is_truncated | boolean | | No | #### KnowledgeFSSourceFileResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | id | string | | Yes | | name | string | | Yes | | size | number | | No | | type | string | | Yes | #### KnowledgeFSSourceFilesQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | bucket | string | | No | | continuationToken | string | | No | | maxKeys | integer | | No | | prefix | string | | No | #### KnowledgeFSSourceFilesResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | buckets | [ [KnowledgeFSSourceFileBucketResponse](#knowledgefssourcefilebucketresponse) ] | | Yes | #### KnowledgeFSSourceImportFailureResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | code | string | | Yes | | error | string | | Yes | | filename | string | | Yes | #### KnowledgeFSSourceImportFilePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | bucket | string | | No | | id | string | | Yes | | mimeType | string | | No | | name | string | | Yes | #### KnowledgeFSSourceImportFilesPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | files | [ [KnowledgeFSSourceImportFilePayload](#knowledgefssourceimportfilepayload) ] | | Yes | #### KnowledgeFSSourceImportPagePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | lastEditedTime | string | | No | | name | string | | No | | pageId | string | | Yes | | type | string | | Yes | | workspaceId | string | | Yes | #### KnowledgeFSSourceImportPagesPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | pages | [ [KnowledgeFSSourceImportPagePayload](#knowledgefssourceimportpagepayload) ] | | Yes | #### KnowledgeFSSourceImportResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | documents | [ [KnowledgeFSSourceImportedDocumentResponse](#knowledgefssourceimporteddocumentresponse) ] | | Yes | | failed | [ [KnowledgeFSSourceImportFailureResponse](#knowledgefssourceimportfailureresponse) ] | | Yes | | skipped | [ string ] | | Yes | #### KnowledgeFSSourceImportedDocumentResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | document_asset_id | string | | Yes | | filename | string | | Yes | #### KnowledgeFSSourceListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [KnowledgeFSSourceResponse](#knowledgefssourceresponse) ] | | Yes | | next_cursor | string | | No | #### KnowledgeFSSourcePageResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | last_edited_time | string | | No | | page_id | string | | Yes | | page_name | string | | Yes | | parent_id | string | | No | | type | string | | Yes | #### KnowledgeFSSourcePagesQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | cursor | string | | No | | limit | integer,
**Default:** 50 | | No | #### KnowledgeFSSourcePagesResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | next_cursor | string | | No | | workspaces | [ [KnowledgeFSSourceWorkspacePagesResponse](#knowledgefssourceworkspacepagesresponse) ] | | Yes | #### KnowledgeFSSourceResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | connection_id | string | | No | | created_at | dateTime | | Yes | | credential_configured | boolean | | No | | id | string | | Yes | | knowledge_space_id | string | | Yes | | last_synced_at | string | | No | | metadata | object | | Yes | | name | string | | Yes | | permission_scope | [ string ] | | Yes | | status | string,
**Available values:** "active", "disabled", "error", "syncing" | *Enum:* `"active"`, `"disabled"`, `"error"`, `"syncing"` | Yes | | sync_policy | [KnowledgeFSSourceSyncPolicyResponse](#knowledgefssourcesyncpolicyresponse) | | No | | sync_workflow | [KnowledgeFSSourceWorkflowResponse](#knowledgefssourceworkflowresponse) | | No | | type | string,
**Available values:** "connector", "object-storage", "upload", "web" | *Enum:* `"connector"`, `"object-storage"`, `"upload"`, `"web"` | Yes | | updated_at | dateTime | | Yes | | uri | string | | Yes | | version | integer | | Yes | #### KnowledgeFSSourceSyncPolicyResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | created_at | dateTime | | Yes | | custom_interval_seconds | integer | | No | | enabled | boolean | | Yes | | expected_source_version | integer | | Yes | | id | string | | Yes | | knowledge_space_id | string | | Yes | | mode | string,
**Available values:** "custom", "interval", "manual", "provider" | *Enum:* `"custom"`, `"interval"`, `"manual"`, `"provider"` | Yes | | next_run_at | string | | No | | revision | integer | | Yes | | source_id | string | | Yes | | updated_at | dateTime | | Yes | #### KnowledgeFSSourceUpdatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | expectedVersion | integer | | No | | metadata | object | | No | | name | string | | No | | status | string | | No | #### KnowledgeFSSourceWorkflowResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | canceled_at | string | | No | | checkpoint | string | | Yes | | completed_at | string | | No | | created_at | dateTime | | Yes | | cursor | string | | No | | execution_attempts | integer | | Yes | | id | string | | Yes | | kind | string | | Yes | | knowledge_space_id | string | | Yes | | last_error_code | string | | No | | last_error_message | string | | No | | max_execution_attempts | integer | | Yes | | progress_completed | integer | | Yes | | progress_failed | integer | | Yes | | progress_skipped | integer | | Yes | | progress_total | integer | | No | | source_id | string | | No | | state | string | | Yes | | updated_at | dateTime | | Yes | #### KnowledgeFSSourceWorkspacePagesResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | pages | [ [KnowledgeFSSourcePageResponse](#knowledgefssourcepageresponse) ] | | Yes | | total | integer | | No | | workspace_id | string | | No | | workspace_name | string | | No | #### KnowledgeFSTraceEntriesQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | cursor | string | | No | | limit | integer,
**Default:** 100 | | No | #### KnowledgeFSTraceEntryListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | consistency_class | string | | No | | data | [ [KnowledgeFSTraceEntryResponse](#knowledgefstraceentryresponse) ] | | Yes | | next_cursor | string | | No | | path | string | | Yes | | preview | boolean | | No | | truncated | boolean | | Yes | #### KnowledgeFSTraceEntryResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | kind | string,
**Available values:** "directory", "resource" | *Enum:* `"directory"`, `"resource"` | Yes | | metadata | object | | Yes | | name | string | | Yes | | path | string | | Yes | | resource_type | string | | No | | target_id | string | | No | | version | integer | | No | #### KnowledgeFSTraceListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [KnowledgeFSTraceResponse](#knowledgefstraceresponse) ] | | Yes | | next_cursor | string | | No | #### KnowledgeFSTraceProfileResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | embedding_model | string | | No | | embedding_vector_space_id | string | | No | | projection_publication_id | string | | No | | projection_version | integer | | No | | reasoning_model | string | | No | | rerank_model | string | | No | | retrieval_profile_revision | integer | | No | #### KnowledgeFSTraceResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | completed | boolean | | Yes | | created_at | dateTime | | Yes | | duration_ms | integer | | No | | evidence_bundle_id | string | | No | | evidence_state | string | | No | | final_score | number | | No | | id | string | | Yes | | mode | string,
**Available values:** "auto", "deep", "fast", "research" | *Enum:* `"auto"`, `"deep"`, `"fast"`, `"research"` | Yes | | profile | [KnowledgeFSTraceProfileResponse](#knowledgefstraceprofileresponse) | | Yes | | query | string | | Yes | | result_count | integer | | Yes | | scores | [KnowledgeFSTraceScoresResponse](#knowledgefstracescoresresponse) | | Yes | | stages | [ [KnowledgeFSTraceStageResponse](#knowledgefstracestageresponse) ] | | Yes | #### KnowledgeFSTraceScoresResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | final | number | | No | | rerank | number | | No | | retrieval | number | | No | #### KnowledgeFSTraceStageResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | candidate_count | integer | | No | | name | string | | Yes | | status | string,
**Available values:** "error", "ok", "skipped" | *Enum:* `"error"`, `"ok"`, `"skipped"` | Yes | #### KnowledgeTagListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | KnowledgeTagListResponse | array | | | #### KnowledgeTagResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | binding_count | string | | No | | id | string | | Yes | | name | string | | Yes | | type | string | | Yes | #### MessageFeedbackPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | content | string | Optional text feedback providing additional detail. | No | | rating | string | Feedback rating. Set to `null` to revoke previously submitted feedback. | No | #### MessageFeedbackPayloadWithUser | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | content | string | Optional text feedback providing additional detail. | No | | rating | string | Feedback rating. Set to `null` to revoke previously submitted feedback. | No | | user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | Yes | #### MessageFile | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | belongs_to | string | | No | | filename | string | | Yes | | id | string | | Yes | | mime_type | string | | No | | size | integer | | No | | transfer_method | string | | Yes | | type | string | | Yes | | upload_file_id | string | | No | | url | string | | No | #### MessageInfiniteScrollPagination | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [MessageListItem](#messagelistitem) ] | | Yes | | has_more | boolean | | Yes | | limit | integer | | Yes | #### MessageListItem | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | agent_thoughts | [ [AgentThought](#agentthought) ] | | Yes | | answer | string | | Yes | | answer_tokens | integer | | No | | conversation_id | string | | Yes | | created_at | integer | | No | | currency | string | | No | | error | string | | No | | extra_contents | [ [HumanInputContent](#humaninputcontent) ] | | Yes | | feedback | [SimpleFeedback](#simplefeedback) | | No | | id | string | | Yes | | inputs | object | | Yes | | message_files | [ [MessageFile](#messagefile) ] | | Yes | | message_tokens | integer | | No | | parent_message_id | string | | No | | provider_response_latency | number | | No | | query | string | | Yes | | retriever_resources | [ [RetrieverResource](#retrieverresource) ] | | Yes | | status | string | | Yes | | total_price | string | | No | | total_tokens | integer | | Yes | #### MessageListQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | conversation_id | string | Conversation ID. | Yes | | first_id | string | The ID of the first chat record on the current page. Omit this value to fetch the latest messages; for subsequent pages, use the first message ID from the current list to fetch older messages. | No | | limit | integer,
**Default:** 20 | Number of chat history messages to return per request. | No | #### MetadataArgs | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | name | string | Metadata field name. | Yes | | type | string,
**Available values:** "number", "string", "time" | `string` for text values, `number` for numeric values, `time` for date/time values.
*Enum:* `"number"`, `"string"`, `"time"` | Yes | #### MetadataDetail | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | id | string (uuid) | Metadata field ID. | Yes | | name | string | Metadata field name. | Yes | | value | string
integer
number | Metadata value. Can be a string, number, or `null`. | No | #### MetadataFilteringCondition Metadata Filtering Condition. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | conditions | [ [Condition](#condition) ] | List of metadata conditions to evaluate. | No | | logical_operator | string | How to combine multiple conditions. | No | #### MetadataOperationData Metadata operation data | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | operation_data | [ [DocumentMetadataOperation](#documentmetadataoperation) ] | Array of document metadata update operations. Each entry maps a document ID to its metadata values. | Yes | #### MetadataUpdatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | name | string | New metadata field name. | Yes | #### ModelFeature Enum class for llm feature. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | ModelFeature | string | Enum class for llm feature. | | #### ModelPropertyKey Enum class for model property key. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | ModelPropertyKey | string | Enum class for model property key. | | #### ModelStatus Enum class for model status. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | ModelStatus | string | Enum class for model status. | | #### ModelType Enum class for model type. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | ModelType | string | Enum class for model type. | | #### OptionalServiceApiUserPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | No | #### ParagraphInputConfig Form input definition. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | default | [StringSource](#stringsource) | | No | | output_variable_name | string | | Yes | | type | string | | No | #### Parameters | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | annotation_reply | [JSONObject](#jsonobject) | | Yes | | file_upload | [JSONObject](#jsonobject) | | Yes | | more_like_this | [JSONObject](#jsonobject) | | Yes | | opening_statement | | | No | | retriever_resource | [JSONObject](#jsonobject) | | Yes | | sensitive_word_avoidance | [JSONObject](#jsonobject) | | Yes | | speech_to_text | [JSONObject](#jsonobject) | | Yes | | suggested_questions | [ string ] | | Yes | | suggested_questions_after_answer | [JSONObject](#jsonobject) | | Yes | | system_parameters | [SystemParameters](#systemparameters) | | Yes | | text_to_speech | [JSONObject](#jsonobject) | | Yes | | user_input_form | [ [JSONObject](#jsonobject) ] | | Yes | #### PermissionEnum Shared permission levels for resources (datasets, credentials, etc.) | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | PermissionEnum | string | Shared permission levels for resources (datasets, credentials, etc.) | | #### PipelineRunApiEntity | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | datasource_info_list | [ object
object
object
object ] | List of datasource objects to process. The expected item structure depends on `datasource_type`. | Yes | | datasource_type | string,
**Available values:** "local_file", "online_document", "online_drive", "website_crawl" | Type of the datasource. Determines which fields are expected in `datasource_info_list` items.
*Enum:* `"local_file"`, `"online_document"`, `"online_drive"`, `"website_crawl"` | Yes | | inputs | object | Key-value pairs for pipeline input variables defined in the workflow. Pass `{}` if the pipeline has no input variables. | Yes | | is_published | boolean | Whether to run the published or draft version of the pipeline. `true` runs the latest published version; `false` runs the current draft (useful for testing unpublished changes). | Yes | | response_mode | string,
**Available values:** "blocking", "streaming" | Response mode. Use `streaming` for SSE or `blocking` for JSON.
*Enum:* `"blocking"`, `"streaming"` | Yes | | start_node_id | string | ID of the datasource node where the run starts. | Yes | #### PipelineUploadFileResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | created_at | string | | No | | created_by | string | | Yes | | extension | string | | Yes | | id | string | | Yes | | mime_type | string | | No | | name | string | | Yes | | size | integer | | Yes | #### PreProcessingRule | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | enabled | boolean | Whether this preprocessing rule is enabled. | Yes | | id | string,
**Available values:** "remove_extra_spaces", "remove_stopwords", "remove_urls_emails" | Rule identifier.
*Enum:* `"remove_extra_spaces"`, `"remove_stopwords"`, `"remove_urls_emails"` | Yes | #### ProcessRule | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | mode | [ProcessRuleMode](#processrulemode) | Processing mode. `automatic` uses built-in rules, `custom` allows manual configuration, and `hierarchical` enables parent-child chunk structure for `doc_form: hierarchical_model`. | Yes | | rules | [Rule](#rule) | Custom processing rules. | No | #### ProcessRuleMode Dataset Process Rule Mode | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | ProcessRuleMode | string | Dataset Process Rule Mode | | #### ProviderModelWithStatusEntity Model class for model response. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | deprecated | boolean | | No | | features | [ [ModelFeature](#modelfeature) ] | | No | | fetch_from | [FetchFrom](#fetchfrom) | | Yes | | has_invalid_load_balancing_configs | boolean | | No | | label | [I18nObject](#i18nobject) | | Yes | | load_balancing_enabled | boolean | | No | | model | string | | Yes | | model_properties | object | | Yes | | model_type | [ModelType](#modeltype) | | Yes | | status | [ModelStatus](#modelstatus) | | Yes | #### ProviderWithModelsListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [ProviderWithModelsResponse](#providerwithmodelsresponse) ] | | Yes | #### ProviderWithModelsResponse Model class for provider with models response. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | icon_small | [I18nObject](#i18nobject) | | No | | icon_small_dark | [I18nObject](#i18nobject) | | No | | label | [I18nObject](#i18nobject) | | Yes | | models | [ [ProviderModelWithStatusEntity](#providermodelwithstatusentity) ] | | Yes | | provider | string | | Yes | | status | [CustomConfigurationStatus](#customconfigurationstatus) | | Yes | | tenant_id | string | | Yes | #### RequiredServiceApiUserPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | Yes | #### RerankingModel | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | reranking_model_name | string | Name of the reranking model. | No | | reranking_provider_name | string | Provider name of the reranking model. | No | #### ResultResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | result | string | | Yes | #### RetrievalMethod | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | RetrievalMethod | string | | | #### RetrievalModel | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | metadata_filtering_conditions | [MetadataFilteringCondition](#metadatafilteringcondition) | Restrict retrieval to chunks whose document metadata matches the given conditions. Conditions are evaluated server-side against document metadata fields. | No | | reranking_enable | boolean | Whether reranking is enabled. | Yes | | reranking_mode | string | Reranking mode. Required when `reranking_enable` is `true`. | No | | reranking_model | [RerankingModel](#rerankingmodel) | Reranking model configuration. | No | | score_threshold | number | Minimum similarity score for results. Only effective when score threshold filtering is enabled. | No | | score_threshold_enabled | boolean | Whether score threshold filtering is enabled. | Yes | | search_method | [RetrievalMethod](#retrievalmethod) | Search method used for retrieval. | Yes | | top_k | integer | Maximum number of results to return. | Yes | | weights | [WeightModel](#weightmodel) | Weight configuration for hybrid search. | No | #### RetrieverResource | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | content | string | | No | | created_at | integer | | No | | data_source_type | string | | No | | dataset_id | string | | No | | dataset_name | string | | No | | document_id | string | | No | | document_name | string | | No | | hit_count | integer | | No | | id | string | | No | | index_node_hash | string | | No | | message_id | string | | No | | position | integer | | Yes | | score | number | | No | | segment_id | string | | No | | segment_position | integer | | No | | summary | string | | No | | word_count | integer | | No | #### Rule | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | parent_mode | string | Parent-child segmentation mode. | No | | pre_processing_rules | [ [PreProcessingRule](#preprocessingrule) ] | Pre-processing rules to apply before segmentation. | No | | segmentation | [Segmentation](#segmentation) | Parent chunk segmentation settings. | No | | subchunk_segmentation | [Segmentation](#segmentation) | Child chunk segmentation settings. | No | #### SegmentAttachmentResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | extension | string | | Yes | | id | string | | Yes | | mime_type | string | | Yes | | name | string | | Yes | | size | integer | | Yes | | source_url | string | | Yes | #### SegmentCreateItemPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | answer | string | Answer content for QA mode. | No | | attachment_ids | [ string ] | Attachment file IDs. | No | | content | string | Chunk text content. | Yes | | keywords | [ string ] | Keywords for the chunk. | No | #### SegmentCreateListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [SegmentResponse](#segmentresponse) ] | | Yes | | doc_form | string | | Yes | #### SegmentCreatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | segments | [ [SegmentCreateItemPayload](#segmentcreateitempayload) ] | Array of chunk objects to create. | Yes | #### SegmentDetailResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [SegmentResponse](#segmentresponse) | | Yes | | doc_form | string | | Yes | #### SegmentListQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | keyword | string | Search keyword. | No | | limit | integer,
**Default:** 20 | Number of items per page. Server caps at `100`. | No | | page | integer,
**Default:** 1 | Page number to retrieve. | No | | status | [ string ] | Filter chunks by indexing status, such as `completed`, `indexing`, or `error`. | No | #### SegmentListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [SegmentResponse](#segmentresponse) ] | | Yes | | doc_form | string | | Yes | | has_more | boolean | | Yes | | limit | integer | | Yes | | page | integer | | Yes | | total | integer | | Yes | #### SegmentResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | answer | string | | Yes | | attachments | [ [SegmentAttachmentResponse](#segmentattachmentresponse) ] | | Yes | | child_chunks | [ [ChildChunkResponse](#childchunkresponse) ] | | Yes | | completed_at | integer | | Yes | | content | string | | Yes | | created_at | integer | | Yes | | created_by | string | | Yes | | disabled_at | integer | | Yes | | disabled_by | string | | Yes | | document_id | string | | Yes | | enabled | boolean | | Yes | | error | string | | Yes | | hit_count | integer | | Yes | | id | string | | Yes | | index_node_hash | string | | Yes | | index_node_id | string | | Yes | | indexing_at | integer | | Yes | | keywords | [ string ] | | Yes | | position | integer | | Yes | | sign_content | string | | Yes | | status | string | | Yes | | stopped_at | integer | | Yes | | summary | string | | Yes | | tokens | integer | | Yes | | updated_at | integer | | Yes | | updated_by | string | | Yes | | word_count | integer | | Yes | #### SegmentUpdateArgs | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | answer | string | Updated answer content for QA mode. | No | | attachment_ids | [ string ] | Attachment file IDs. | No | | content | string | Updated chunk text content. | No | | enabled | boolean | Whether the chunk is enabled. | No | | keywords | [ string ] | Updated keywords for the chunk. | No | | regenerate_child_chunks | boolean | Whether to regenerate child chunks after updating a parent chunk. | No | | summary | string | Summary content for summary index. | No | #### SegmentUpdatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | segment | [SegmentUpdateArgs](#segmentupdateargs) | Chunk update payload. | Yes | #### Segmentation | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | chunk_overlap | integer | Token overlap between chunks. | No | | max_tokens | integer | Maximum token count per chunk. | Yes | | separator | string,
**Default:** | Custom separator for splitting text. | No | #### SelectInputConfig | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | option_source | [StringListSource](#stringlistsource) | | Yes | | output_variable_name | string | | Yes | | type | string | | No | #### SimpleAccountResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | email | string | | Yes | | id | string | | Yes | | name | string | | Yes | #### SimpleConversation | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | created_at | integer | | No | | id | string | | Yes | | inputs | object | | Yes | | introduction | string | | No | | name | string | | Yes | | status | string | | Yes | | updated_at | integer | | No | #### SimpleEndUser | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | id | string | | Yes | | is_anonymous | boolean | | Yes | | session_id | string | | No | | type | string | | Yes | #### SimpleFeedback | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | rating | string | | No | #### SimpleResultResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | result | string | | Yes | #### SimpleResultStringListResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ string ] | | Yes | | result | string | | Yes | #### Site | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | chat_color_theme | string | | No | | chat_color_theme_inverted | boolean | | Yes | | copyright | string | | No | | custom_disclaimer | string | | No | | default_language | string | | Yes | | description | string | | No | | icon | string | | No | | icon_background | string | | No | | icon_type | string | | No | | icon_url | string | | Yes | | input_placeholder | string | | No | | privacy_policy | string | | No | | show_workflow_steps | boolean | | Yes | | title | string | | Yes | | use_icon_as_answer_icon | boolean | | Yes | #### StringListSource | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | selector | [ string ] | | No | | type | [ValueSourceType](#valuesourcetype) | | Yes | | value | [ string ] | | No | #### StringSource Default configuration for form inputs. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | selector | [ string ] | | No | | type | [ValueSourceType](#valuesourcetype) | | Yes | | value | string | | No | #### SystemParameters | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | audio_file_size_limit | integer | | Yes | | file_size_limit | integer | | Yes | | image_file_size_limit | integer | | Yes | | video_file_size_limit | integer | | Yes | | workflow_file_upload_limit | integer | | Yes | #### TagBindingPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | tag_ids | [ string ] | Tag IDs to bind. | Yes | | target_id | string | Knowledge base ID to bind the tags to. | Yes | #### TagCreatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | name | string | Tag name. | Yes | #### TagDeletePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | tag_id | string | Tag ID to delete. | Yes | #### TagUnbindingPayload Accepts either the legacy tag_id payload or the normalized tag_ids payload. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | TagUnbindingPayload | object
object | Accepts either the legacy tag_id payload or the normalized tag_ids payload. | | #### TagUpdatePayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | name | string | Tag name. | Yes | | tag_id | string | Tag ID to update. | Yes | #### TextToAudioPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | message_id | string | Message ID. Takes priority over `text` when both are provided. | No | | streaming | boolean | Reserved for compatibility; TTS response streaming is determined by the provider output. | No | | text | string | Speech content to convert. | No | | voice | string | Voice to use for text-to-speech. Available voices depend on the TTS provider configured for this app. Omit to use the app's configured voice when available; that value is exposed by [Get App Parameters](/api-reference/applications/get-app-parameters) as `text_to_speech.voice`. | No | #### TextToAudioPayloadWithUser | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | message_id | string | Message ID. Takes priority over `text` when both are provided. | No | | streaming | boolean | Reserved for compatibility; TTS response streaming is determined by the provider output. | No | | text | string | Speech content to convert. | No | | user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | No | | voice | string | Voice to use for text-to-speech. Available voices depend on the TTS provider configured for this app. Omit to use the app's configured voice when available; that value is exposed by [Get App Parameters](/api-reference/applications/get-app-parameters) as `text_to_speech.voice`. | No | #### UrlResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | url | string | | Yes | #### UserActionConfig User action configuration. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | button_style | [ButtonStyle](#buttonstyle) | | No | | id | string | | Yes | | title | string | | Yes | #### ValueSourceType ValueSourceType records whether the value comes from a static setting in form definition, or a variable while the workflow is running. | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | ValueSourceType | string | ValueSourceType records whether the value comes from a static setting in form definition, or a variable while the workflow is running. | | #### WeightKeywordSetting | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | keyword_weight | number | Weight assigned to keyword search results. | Yes | #### WeightModel | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | keyword_setting | [WeightKeywordSetting](#weightkeywordsetting) | Keyword search weight settings. | No | | vector_setting | [WeightVectorSetting](#weightvectorsetting) | Semantic search weight settings. | No | | weight_type | string | Strategy for balancing semantic and keyword search weights. | No | #### WeightVectorSetting | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | embedding_model_name | string | Name of the embedding model used for vector search. | Yes | | embedding_provider_name | string | Provider of the embedding model used for vector search. | Yes | | vector_weight | number | Weight assigned to semantic vector search results. | Yes | #### WorkflowAppLogPaginationResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | data | [ [WorkflowAppLogPartialResponse](#workflowapplogpartialresponse) ] | | Yes | | has_more | boolean | | Yes | | limit | integer | | Yes | | page | integer | | Yes | | total | integer | | Yes | #### WorkflowAppLogPartialResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | created_at | integer | | No | | created_by_account | [SimpleAccountResponse](#simpleaccountresponse) | | No | | created_by_end_user | [SimpleEndUser](#simpleenduser) | | No | | created_by_role | string | | No | | created_from | string | | No | | details | object
[ object ]
string
integer
number
boolean | | No | | id | string | | Yes | | workflow_run | [WorkflowRunForLogResponse](#workflowrunforlogresponse) | | No | #### WorkflowEventsQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | continue_on_pause | boolean | Set to `true` to keep the stream open across multiple `workflow_paused` events, which is useful when the workflow has more than one Human Input node in sequence. By default, the stream closes after the first pause. | No | | include_state_snapshot | boolean | When `true`, replay from the persisted state snapshot to include a status summary of already-executed nodes before streaming new events. | No | | user | string | End-user identifier that originally triggered the run. Must match the creator of the run. | Yes | #### WorkflowLogQuery | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | created_at__after | string | Filter logs created after this ISO 8601 timestamp. | No | | created_at__before | string | Filter logs created before this ISO 8601 timestamp. | No | | created_by_account | string | Filter by account ID. | No | | created_by_end_user_session_id | string | Filter by end user session ID. | No | | keyword | string | Keyword to search in logs. | No | | limit | integer,
**Default:** 20 | Number of items per page. | No | | page | integer,
**Default:** 1 | Page number for pagination. | No | | status | string | Filter by execution status. | No | #### WorkflowRunForLogResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | created_at | integer | | No | | elapsed_time | number
integer | | No | | error | string | | No | | exceptions_count | integer | | No | | finished_at | integer | | No | | id | string | | Yes | | status | string | | No | | total_steps | integer | | No | | total_tokens | integer | | No | | triggered_from | string | | No | | version | string | | No | #### WorkflowRunPayload | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | files | [ object ] | File list for workflow system file inputs. Available when file upload is enabled for the workflow. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No | | inputs | object | Key-value pairs for workflow input variables. Values for file-type variables should be arrays of file objects with `type`, `transfer_method`, and either `url` or `upload_file_id`. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover the variable names and types expected by your app. | Yes | | response_mode | string | Response mode. Use `blocking` for synchronous responses or `streaming` for Server-Sent Events. When omitted, the request runs in blocking mode. | No | #### WorkflowRunPayloadWithUser | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | files | [ object ] | File list for workflow system file inputs. Available when file upload is enabled for the workflow. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No | | inputs | object | Key-value pairs for workflow input variables. Values for file-type variables should be arrays of file objects with `type`, `transfer_method`, and either `url` or `upload_file_id`. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover the variable names and types expected by your app. | Yes | | response_mode | string | Response mode. Use `blocking` for synchronous responses or `streaming` for Server-Sent Events. When omitted, the request runs in blocking mode. | No | | user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | Yes | #### WorkflowRunResponse | Name | Type | Description | Required | | ---- | ---- | ----------- | -------- | | created_at | integer | | No | | elapsed_time | number
integer | | No | | error | string | | No | | finished_at | integer | | No | | id | string | | Yes | | inputs | object
[ object ]
string
integer
number
boolean | | No | | outputs | object | | No | | status | string | | Yes | | total_steps | integer | | No | | total_tokens | integer | | No | | workflow_id | string | | Yes |