mirror of
https://github.com/langgenius/dify.git
synced 2026-09-06 17:25:12 +08:00
Drop the deprecated `POST /knowledge-fs/spaces/<id>/queries` route and the deprecated buffered `POST .../documents` upload from the service API. Both only ever failed closed; queries go through admission + the query stream, documents through the durable source import flow. Regenerate the service contracts and markdown docs accordingly. Co-Authored-By: Claude Fable 5.1 <noreply@anthropic.com> Claude-Session: https://claude.ai/code/session_015zw5G5SX3HmVfnZof6YWAc
6134 lines
268 KiB
Markdown
6134 lines
268 KiB
Markdown
# Service API
|
|
API for application services
|
|
|
|
## Version: 1.0
|
|
|
|
### Available authorizations
|
|
#### Bearer (HTTP, bearer)
|
|
Use the Service API key as a Bearer token in the Authorization header.
|
|
Bearer format: API_KEY
|
|
|
|
---
|
|
## service_api
|
|
Service operations
|
|
|
|
### [GET] /
|
|
**Return public Service API metadata without requiring an API key**
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [IndexInfoResponse](#indexinforesponse)<br> |
|
|
|
|
### ~~[POST] /datasets/{dataset_id}/document/create_by_text~~
|
|
|
|
***DEPRECATED***
|
|
|
|
**Create document by text through the deprecated underscore alias**
|
|
|
|
Deprecated legacy alias for creating a new document by providing text content. Use /datasets/{dataset_id}/document/create-by-text instead.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DocumentTextCreatePayload](#documenttextcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document created successfully | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)<br> |
|
|
| 400 | Bad request - invalid parameters | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | `not_found` : Knowledge base not found. | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
### ~~[POST] /datasets/{dataset_id}/documents/{document_id}/update_by_text~~
|
|
|
|
***DEPRECATED***
|
|
|
|
**Update document by text through the deprecated underscore alias**
|
|
|
|
Deprecated legacy alias for updating an existing document by providing text content. Use /datasets/{dataset_id}/documents/{document_id}/update-by-text instead.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DocumentTextUpdate](#documenttextupdate)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document updated successfully | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Document not found | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
### [POST] /knowledge-fs/query-stream
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSAdmittedQueryRequest](#knowledgefsadmittedqueryrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS query event stream | **text/event-stream**: string<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/bulk-jobs/{job_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| job_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS bulk job | **application/json**: [KnowledgeFSBulkJobResponse](#knowledgefsbulkjobresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS documents | **application/json**: [KnowledgeFSDocumentListResponse](#knowledgefsdocumentlistresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/documents/bulk
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSBulkDocumentDeletePayload](#knowledgefsbulkdocumentdeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS document deletions accepted | **application/json**: [KnowledgeFSBulkDeletionAcceptedResponse](#knowledgefsbulkdeletionacceptedresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/documents/reindex
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSDocumentReindexPayload](#knowledgefsdocumentreindexpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document reindex queued | **application/json**: [KnowledgeFSDocumentReindexResponse](#knowledgefsdocumentreindexresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSDocumentDeletePayload](#knowledgefsdocumentdeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS document deletion accepted | **application/json**: [KnowledgeFSDurableDeletionAcceptedResponse](#knowledgefsdurabledeletionacceptedresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document | **application/json**: [KnowledgeFSDocumentResponse](#knowledgefsdocumentresponse)<br> |
|
|
|
|
### [PATCH] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSDocumentMetadataPayload](#knowledgefsdocumentmetadatapayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document metadata updated | **application/json**: [KnowledgeFSLogicalDocumentResponse](#knowledgefslogicaldocumentresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/outline
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document outline | **application/json**: [KnowledgeFSDocumentOutlineResponse](#knowledgefsdocumentoutlineresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/revisions
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document revisions | **application/json**: [KnowledgeFSDocumentRevisionListResponse](#knowledgefsdocumentrevisionlistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/revisions/{revision}/chunks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| query | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
| revision | path | | Yes | integer |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document chunks | **application/json**: [KnowledgeFSDocumentChunkListResponse](#knowledgefsdocumentchunklistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/revisions/{revision}/chunks/{chunk_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| chunk_id | path | | Yes | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
| revision | path | | Yes | integer |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document chunk | **application/json**: [KnowledgeFSDocumentChunkResponse](#knowledgefsdocumentchunkresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/jobs/{job_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| job_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS compilation job canceled | **application/json**: [KnowledgeFSDocumentCompilationJobResponse](#knowledgefsdocumentcompilationjobresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/jobs/{job_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| job_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS compilation job | **application/json**: [KnowledgeFSDocumentCompilationJobResponse](#knowledgefsdocumentcompilationjobresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/jobs/{job_id}/retry
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| job_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS compilation job retried | **application/json**: [KnowledgeFSDocumentCompilationJobResponse](#knowledgefsdocumentcompilationjobresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/queries/admission
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSQueryCreatePayload](#knowledgefsquerycreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS streaming query admitted through Dify API | **application/json**: [KnowledgeFSQueryAdmissionResponse](#knowledgefsqueryadmissionresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/research-tasks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS research tasks | **application/json**: [KnowledgeFSResearchTaskListResponse](#knowledgefsresearchtasklistresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/research-tasks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSResearchTaskCreatePayload](#knowledgefsresearchtaskcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS research task accepted | **application/json**: [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/research-tasks/plan
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSResearchTaskPlanPayload](#knowledgefsresearchtaskplanpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS research task plan | **application/json**: [KnowledgeFSResearchTaskPlanResponse](#knowledgefsresearchtaskplanresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/research-tasks/{task_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS research task canceled | **application/json**: [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/research-tasks/{task_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS research task | **application/json**: [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/research-tasks/{task_id}/partials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 25 |
|
|
| control_space_id | path | | Yes | string |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS research task partial evidence | **application/json**: [KnowledgeFSResearchTaskPartialListResponse](#knowledgefsresearchtaskpartiallistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/settings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS settings | **application/json**: [KnowledgeFSSettingsResponse](#knowledgefssettingsresponse)<br> |
|
|
|
|
### [PATCH] /knowledge-fs/spaces/{control_space_id}/settings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSettingsPayload](#knowledgefssettingspayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS settings updated | **application/json**: [KnowledgeFSSettingsResponse](#knowledgefssettingsresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/sources
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS sources | **application/json**: [KnowledgeFSSourceListResponse](#knowledgefssourcelistresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceCreatePayload](#knowledgefssourcecreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | KnowledgeFS source created | **application/json**: [KnowledgeFSSourceResponse](#knowledgefssourceresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| documents | query | | No | string, <br>**Available values:** "cascade", "keep", <br>**Default:** cascade |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceDeletePayload](#knowledgefssourcedeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS source deletion accepted | **application/json**: [KnowledgeFSDurableDeletionAcceptedResponse](#knowledgefsdurabledeletionacceptedresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source | **application/json**: [KnowledgeFSSourceResponse](#knowledgefssourceresponse)<br> |
|
|
|
|
### [PATCH] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceUpdatePayload](#knowledgefssourceupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source updated | **application/json**: [KnowledgeFSSourceResponse](#knowledgefssourceresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/crawl
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source crawl | **application/json**: [KnowledgeFSSourceCrawlResponse](#knowledgefssourcecrawlresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/files
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| bucket | query | | No | string |
|
|
| continuationToken | query | | No | string |
|
|
| maxKeys | query | | No | integer |
|
|
| prefix | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source files | **application/json**: [KnowledgeFSSourceFilesResponse](#knowledgefssourcefilesresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/import
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceImportPagesPayload](#knowledgefssourceimportpagespayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source pages imported | **application/json**: [KnowledgeFSSourceImportResponse](#knowledgefssourceimportresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/import-files
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceImportFilesPayload](#knowledgefssourceimportfilespayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source files imported | **application/json**: [KnowledgeFSSourceImportResponse](#knowledgefssourceimportresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/pages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 50 |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source pages | **application/json**: [KnowledgeFSSourcePagesResponse](#knowledgefssourcepagesresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/test
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source credential test | **application/json**: [KnowledgeFSSourceCredentialTestResponse](#knowledgefssourcecredentialtestresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/traces
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS traces | **application/json**: [KnowledgeFSTraceListResponse](#knowledgefstracelistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| trace_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS answer trace | **application/json**: [KnowledgeFSAnswerTraceResponse](#knowledgefsanswertraceresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id}/conflicts
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 100 |
|
|
| control_space_id | path | | Yes | string |
|
|
| trace_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS trace conflicts | **application/json**: [KnowledgeFSTraceEntryListResponse](#knowledgefstraceentrylistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id}/evidence
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 100 |
|
|
| control_space_id | path | | Yes | string |
|
|
| trace_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS trace evidence view | **application/json**: [KnowledgeFSTraceEntryListResponse](#knowledgefstraceentrylistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id}/missing
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 100 |
|
|
| control_space_id | path | | Yes | string |
|
|
| trace_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS trace missing evidence | **application/json**: [KnowledgeFSTraceEntryListResponse](#knowledgefstraceentrylistresponse)<br> |
|
|
|
|
---
|
|
## default
|
|
|
|
### [GET] /app/feedbacks
|
|
**List App Feedbacks**
|
|
|
|
Retrieve a paginated list of all feedback submitted for messages in this application, including both end-user and admin feedback.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| limit | query | Number of records per page. | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number for pagination. | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | A list of application feedbacks. | **application/json**: [AppFeedbackListResponse](#appfeedbacklistresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
|
|
### [POST] /messages/{message_id}/feedbacks
|
|
**Submit Message Feedback**
|
|
|
|
Submit feedback for a message. End users can rate messages as `like` or `dislike`, and optionally provide text feedback. Pass `null` for `rating` to revoke previously submitted feedback.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| message_id | path | Message ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MessageFeedbackPayloadWithUser](#messagefeedbackpayloadwithuser)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Feedback submitted successfully | **application/json**: [ResultResponse](#resultresponse)<br> |
|
|
| 400 | Bad request - invalid feedback payload | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Message does not exist. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [POST] /apps/annotation-reply/{action}
|
|
**Configure Annotation Reply**
|
|
|
|
Enables or disables the annotation reply feature. Requires embedding model configuration when enabling. Executes asynchronously — use [Get Annotation Reply Job Status](/api-reference/annotations/get-annotation-reply-job-status) to track progress.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | Action to perform: `enable` or `disable`. | Yes | string, <br>**Available values:** "disable", "enable" |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AnnotationReplyActionPayload](#annotationreplyactionpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Annotation reply settings task initiated. | **application/json**: [AnnotationJobStatusResponse](#annotationjobstatusresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
|
|
### [GET] /apps/annotation-reply/{action}/status/{job_id}
|
|
**Get Annotation Reply Job Status**
|
|
|
|
Retrieves the status of an asynchronous annotation reply configuration job started by [Configure Annotation Reply](/api-reference/annotations/configure-annotation-reply).
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | Action to perform: `enable` or `disable`. | Yes | string, <br>**Available values:** "disable", "enable" |
|
|
| job_id | path | Job ID returned by [Configure Annotation Reply](/api-reference/annotations/configure-annotation-reply). | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successfully retrieved task status. | **application/json**: [AnnotationJobStatusDetailResponse](#annotationjobstatusdetailresponse)<br> |
|
|
| 400 | `invalid_param` : The specified job does not exist. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | Job not found | |
|
|
|
|
### [GET] /apps/annotations
|
|
**List Annotations**
|
|
|
|
Retrieves a paginated list of annotations for the application. Supports keyword search filtering.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| keyword | query | Keyword to filter annotations by question or answer content. | No | string |
|
|
| limit | query | Number of items per page. | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number for pagination. | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successfully retrieved annotation list. | **application/json**: [AnnotationList](#annotationlist)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
|
|
### [POST] /apps/annotations
|
|
**Create Annotation**
|
|
|
|
Creates a new annotation. Annotations provide predefined question-answer pairs that the app can match and return directly instead of generating a response.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AnnotationCreatePayload](#annotationcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Annotation created successfully. | **application/json**: [Annotation](#annotation)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
|
|
### [DELETE] /apps/annotations/{annotation_id}
|
|
**Delete Annotation**
|
|
|
|
Deletes an annotation and its associated hit history.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| annotation_id | path | The unique identifier of the annotation to delete. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Annotation deleted successfully. |
|
|
| 401 | Unauthorized - invalid API token |
|
|
| 403 | `forbidden` : Insufficient permissions to edit annotations. |
|
|
| 404 | `not_found` : Annotation does not exist. |
|
|
|
|
### [PUT] /apps/annotations/{annotation_id}
|
|
**Update Annotation**
|
|
|
|
Updates the question and answer of an existing annotation.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| annotation_id | path | The unique identifier of the annotation to update. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AnnotationCreatePayload](#annotationcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Annotation updated successfully. | **application/json**: [Annotation](#annotation)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `forbidden` : Insufficient permissions to edit annotations. | |
|
|
| 404 | `not_found` : Annotation does not exist. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [POST] /audio-to-text
|
|
**Convert Audio to Text**
|
|
|
|
Convert audio file to text. Supported MIME types: `audio/mp3`, `audio/mpga`, `audio/m4a`, `audio/x-m4a`, `audio/wav`, and `audio/amr`. File size limit is `30 MB`.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary, **"user"**: string }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successfully converted audio to text. | **application/json**: [AudioTranscriptResponse](#audiotranscriptresponse)<br> |
|
|
| 400 | - `app_unavailable` : App unavailable or misconfigured. - `speech_to_text_disabled` : Speech-to-text is disabled for this app. - `provider_not_support_speech_to_text` : Model provider does not support speech-to-text. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model does not support this operation. - `completion_request_error` : Speech recognition request failed. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 413 | `audio_too_large` : Audio file size exceeded the limit. | |
|
|
| 415 | `unsupported_audio_type` : Audio type is not allowed. | |
|
|
| 500 | `internal_server_error` : Internal server error. | |
|
|
|
|
### [POST] /text-to-audio
|
|
**Convert Text to Audio**
|
|
|
|
Convert text to speech.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TextToAudioPayloadWithUser](#texttoaudiopayloadwithuser)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Returns the generated audio. The `Content-Type` header reflects the provider audio container, verified from the response bytes when recognizable. The binary response can be AAC, FLAC, MP4, MP3, Ogg, WAV, or WebM. | **audio/aac**: binary<br>**audio/flac**: binary<br>**audio/mp4**: binary<br>**audio/mpeg**: binary<br>**audio/ogg**: binary<br>**audio/wav**: binary<br>**audio/webm**: binary<br> |
|
|
| 400 | - `app_unavailable` : App unavailable or misconfigured. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model does not support this operation. - `completion_request_error` : Text-to-speech request failed. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 500 | `internal_server_error` : Internal server error. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [POST] /chat-messages
|
|
**Send Chat Message**
|
|
|
|
Send a request to the chat application.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChatRequestPayloadWithUser](#chatrequestpayloadwithuser)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successful response. The content type and structure depend on the `response_mode` parameter in the request. - If `response_mode` is `blocking`, returns `application/json` with a `ChatCompletionResponse` object. - If `response_mode` is `streaming`, returns `text/event-stream` with a stream of Server-Sent Events. | **application/json**: [ChatBlockingResponse](#chatblockingresponse)<br>**text/event-stream**: string<br> |
|
|
| 400 | - `app_unavailable` : App unavailable or misconfigured. - `not_chat_app` : App mode does not match the API route. - `conversation_completed` : The conversation has ended. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model unavailable. - `completion_request_error` : Text generation failed. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `workflow_version_execution_not_allowed` : Workflow version execution is unavailable on the current plan. Upgrade to a paid plan. | |
|
|
| 404 | `not_found` : Conversation does not exist. | |
|
|
| 429 | - `too_many_requests` : Too many concurrent requests for this app. - `rate_limit_error` : The upstream model provider rate limit was exceeded. | |
|
|
| 500 | `internal_server_error` : Internal server error. | |
|
|
|
|
### [POST] /chat-messages/{task_id}/stop
|
|
**Stop Chat Message Generation**
|
|
|
|
Stops a chat message generation task. Only supported in `streaming` mode.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| task_id | path | Task ID, obtained from a streaming chunk returned by the Send Chat Message API. | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ScopedTaskStopPayload](#scopedtaskstoppayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 400 | `not_chat_app` : App mode does not match the API route. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
|
|
### [GET] /messages/{message_id}/suggested
|
|
**Get Next Suggested Questions**
|
|
|
|
Get next questions suggestions for the current message.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| message_id | path | Message ID | Yes | string (uuid) |
|
|
| user | query | User identifier, used for end-user context. | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Suggested questions retrieved successfully | **application/json**: [SimpleResultStringListResponse](#simpleresultstringlistresponse)<br> |
|
|
| 400 | - `not_chat_app` : App mode does not match the API route. - `bad_request` : Suggested questions feature is disabled. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Message does not exist. | |
|
|
| 500 | `internal_server_error` : Internal server error. | |
|
|
|
|
### [GET] /workflow/{workflow_run_id}/events
|
|
**Stream Workflow Events**
|
|
|
|
Resume the Server-Sent Events stream for a workflow run after a pause or a dropped SSE connection. For runs that have already finished, the stream emits a single `workflow_finished` event and closes.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| workflow_run_id | path | Workflow run ID returned by the original workflow run request. | Yes | string |
|
|
| continue_on_pause | query | Set to `true` to keep the stream open across multiple `workflow_paused` events, which is useful when the workflow has more than one Human Input node in sequence. By default, the stream closes after the first pause. | No | boolean |
|
|
| include_state_snapshot | query | When `true`, replay from the persisted state snapshot to include a status summary of already-executed nodes before streaming new events. | No | boolean |
|
|
| user | query | End-user identifier that originally triggered the run. Must match the creator of the run. | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Server-Sent Events stream. Each event is delivered as `data: {JSON}\\n\\n`. Event payloads follow the same schemas as the original streaming response. | **text/event-stream**: string<br> |
|
|
| 400 | `not_workflow_app` : Please check if your app mode matches the right API route. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Workflow run not found. | |
|
|
|
|
### [GET] /workflows/logs
|
|
**List Workflow Logs**
|
|
|
|
Retrieve paginated workflow execution logs with filtering options.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| created_at__after | query | Filter logs created after this ISO 8601 timestamp. | No | dateTime |
|
|
| created_at__before | query | Filter logs created before this ISO 8601 timestamp. | No | dateTime |
|
|
| created_by_account | query | Filter by account ID. | No | string |
|
|
| created_by_end_user_session_id | query | Filter by end user session ID. | No | string |
|
|
| keyword | query | Keyword to search in logs. | No | string |
|
|
| limit | query | Number of items per page. | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number for pagination. | No | integer, <br>**Default:** 1 |
|
|
| status | query | Filter by execution status. | No | string, <br>**Available values:** "failed", "stopped", "succeeded" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successfully retrieved workflow logs. | **application/json**: [WorkflowAppLogPaginationResponse](#workflowapplogpaginationresponse)<br> |
|
|
| 400 | Bad request - invalid query parameters | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
|
|
### [GET] /workflows/run/{workflow_run_id}
|
|
**Get Workflow Run Detail**
|
|
|
|
Retrieve the current execution results of a workflow task based on the workflow execution ID.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| workflow_run_id | path | Workflow run ID, obtained from the workflow execution response or streaming events. | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successfully retrieved workflow run details. | **application/json**: [WorkflowRunResponse](#workflowrunresponse)<br> |
|
|
| 400 | `not_workflow_app` : App mode does not match the API route. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Workflow run not found. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [POST] /chat-messages
|
|
**Send Chat Message**
|
|
|
|
Send a request to the chat application.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChatRequestPayloadWithUser](#chatrequestpayloadwithuser)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successful response. The content type and structure depend on the `response_mode` parameter in the request. - If `response_mode` is `blocking`, returns `application/json` with a `ChatCompletionResponse` object. - If `response_mode` is `streaming`, returns `text/event-stream` with a stream of Server-Sent Events. | **application/json**: [ChatBlockingResponse](#chatblockingresponse)<br>**text/event-stream**: string<br> |
|
|
| 400 | - `app_unavailable` : App unavailable or misconfigured. - `not_chat_app` : App mode does not match the API route. - `conversation_completed` : The conversation has ended. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model unavailable. - `completion_request_error` : Text generation failed. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `workflow_version_execution_not_allowed` : Workflow version execution is unavailable on the current plan. Upgrade to a paid plan. | |
|
|
| 404 | `not_found` : Conversation does not exist. | |
|
|
| 429 | - `too_many_requests` : Too many concurrent requests for this app. - `rate_limit_error` : The upstream model provider rate limit was exceeded. | |
|
|
| 500 | `internal_server_error` : Internal server error. | |
|
|
|
|
### [POST] /chat-messages/{task_id}/stop
|
|
**Stop Chat Message Generation**
|
|
|
|
Stops a chat message generation task. Only supported in `streaming` mode.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| task_id | path | Task ID, obtained from a streaming chunk returned by the Send Chat Message API. | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ScopedTaskStopPayload](#scopedtaskstoppayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 400 | `not_chat_app` : App mode does not match the API route. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
|
|
### [GET] /messages/{message_id}/suggested
|
|
**Get Next Suggested Questions**
|
|
|
|
Get next questions suggestions for the current message.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| message_id | path | Message ID | Yes | string (uuid) |
|
|
| user | query | User identifier, used for end-user context. | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Suggested questions retrieved successfully | **application/json**: [SimpleResultStringListResponse](#simpleresultstringlistresponse)<br> |
|
|
| 400 | - `not_chat_app` : App mode does not match the API route. - `bad_request` : Suggested questions feature is disabled. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Message does not exist. | |
|
|
| 500 | `internal_server_error` : Internal server error. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [POST] /completion-messages
|
|
**Send Completion Message**
|
|
|
|
Send a request to the text generation application.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [CompletionRequestPayloadWithUser](#completionrequestpayloadwithuser)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successful response. The content type and structure depend on the `response_mode` parameter in the request. - If `response_mode` is `blocking`, returns `application/json` with a `CompletionResponse` object. - If `response_mode` is `streaming`, returns `text/event-stream` with a stream of `ChunkCompletionEvent` objects. | **application/json**: [CompletionBlockingResponse](#completionblockingresponse)<br>**text/event-stream**: string<br> |
|
|
| 400 | - `app_unavailable` : App unavailable or misconfigured. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model unavailable. - `completion_request_error` : Text generation failed. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | Conversation not found | |
|
|
| 429 | `too_many_requests` : Too many concurrent requests for this app. | |
|
|
| 500 | `internal_server_error` : Internal server error. | |
|
|
|
|
### [POST] /completion-messages/{task_id}/stop
|
|
**Stop Completion Message Generation**
|
|
|
|
Stops a completion message generation task. Only supported in `streaming` mode.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| task_id | path | Task ID, obtained from a streaming chunk returned by the Send Completion Message API. | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ScopedTaskStopPayload](#scopedtaskstoppayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 400 | `app_unavailable` : App unavailable or misconfigured. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [GET] /conversations
|
|
**List Conversations**
|
|
|
|
Retrieve the conversation list for the current user, ordered by most recently active.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| last_id | query | The ID of the last record on the current page. Used to fetch the next page. | No | string |
|
|
| limit | query | Number of records to return. | No | integer, <br>**Default:** 20 |
|
|
| sort_by | query | Sorting field. Use the `-` prefix for descending order. | No | string, <br>**Available values:** "-created_at", "-updated_at", "created_at", "updated_at", <br>**Default:** -updated_at |
|
|
| user | query | User identifier, used for end-user context. | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successfully retrieved conversations list. | **application/json**: [ConversationInfiniteScrollPagination](#conversationinfinitescrollpagination)<br> |
|
|
| 400 | `not_chat_app` : App mode does not match the API route. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Last conversation does not exist (invalid `last_id`). | |
|
|
|
|
### [DELETE] /conversations/{conversation_id}
|
|
**Delete Conversation**
|
|
|
|
Delete a conversation.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| conversation_id | path | Conversation ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [OptionalServiceApiUserPayload](#optionalserviceapiuserpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Conversation deleted successfully. |
|
|
| 400 | `not_chat_app` : App mode does not match the API route. |
|
|
| 401 | Unauthorized - invalid API token |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied |
|
|
| 404 | `not_found` : Conversation does not exist. |
|
|
|
|
### [POST] /conversations/{conversation_id}/name
|
|
**Rename Conversation**
|
|
|
|
Rename a conversation or auto-generate a name. The conversation name is used for display on clients that support multiple conversations.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| conversation_id | path | Conversation ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ConversationRenamePayloadWithUser](#conversationrenamepayloadwithuser)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Conversation renamed successfully. | **application/json**: [SimpleConversation](#simpleconversation)<br> |
|
|
| 400 | `not_chat_app` : App mode does not match the API route. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Conversation does not exist. | |
|
|
|
|
### [GET] /conversations/{conversation_id}/variables
|
|
**List Conversation Variables**
|
|
|
|
Retrieve variables from a specific conversation.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| conversation_id | path | Conversation ID. | Yes | string (uuid) |
|
|
| last_id | query | The ID of the last record on the current page. Used to fetch the next page. | No | string |
|
|
| limit | query | Number of records to return. | No | integer, <br>**Default:** 20 |
|
|
| user | query | User identifier, used for end-user context. | No | string |
|
|
| variable_name | query | Filter variables by a specific name. | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successfully retrieved conversation variables. | **application/json**: [ConversationVariableInfiniteScrollPaginationResponse](#conversationvariableinfinitescrollpaginationresponse)<br> |
|
|
| 400 | `not_chat_app` : App mode does not match the API route. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Conversation does not exist. | |
|
|
|
|
### [PUT] /conversations/{conversation_id}/variables/{variable_id}
|
|
**Update Conversation Variable**
|
|
|
|
Update the value of a specific conversation variable. The value must match the expected type.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| conversation_id | path | Conversation ID. | Yes | string (uuid) |
|
|
| variable_id | path | Variable ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ConversationVariableUpdatePayloadWithUser](#conversationvariableupdatepayloadwithuser)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Variable updated successfully. | **application/json**: [ConversationVariableResponse](#conversationvariableresponse)<br> |
|
|
| 400 | - `not_chat_app` : App mode does not match the API route. - `bad_request` : Variable value type mismatch. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | - `not_found` : Conversation does not exist. - `not_found` : Conversation variable does not exist. | |
|
|
|
|
### [GET] /messages
|
|
**List Conversation Messages**
|
|
|
|
Returns historical chat records in a scrolling load format, with the first page returning the latest `limit` messages, i.e., in reverse order.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| conversation_id | query | Conversation ID. | Yes | string |
|
|
| first_id | query | The ID of the first chat record on the current page. Omit this value to fetch the latest messages; for subsequent pages, use the first message ID from the current list to fetch older messages. | No | string |
|
|
| limit | query | Number of chat history messages to return per request. | No | integer, <br>**Default:** 20 |
|
|
| user | query | User identifier, used for end-user context. | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successfully retrieved conversation history. | **application/json**: [MessageInfiniteScrollPagination](#messageinfinitescrollpagination)<br> |
|
|
| 400 | `not_chat_app` : App mode does not match the API route. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | - `not_found` : Conversation does not exist. - `not_found` : First message does not exist. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [GET] /datasets
|
|
**List Knowledge Bases**
|
|
|
|
Returns a paginated list of knowledge bases. Supports filtering by keyword and tags.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| include_all | query | Whether to include all knowledge bases regardless of permissions. | No | boolean |
|
|
| keyword | query | Search keyword to filter by name. | No | string |
|
|
| limit | query | Number of items per page. Server caps at `100`. | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number to retrieve. | No | integer, <br>**Default:** 1 |
|
|
| tag_ids | query | Tag IDs to filter by. | No | [ string ] |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | List of knowledge bases. | **application/json**: [DatasetListResponse](#datasetlistresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
|
|
### [POST] /datasets
|
|
**Create an Empty Knowledge Base**
|
|
|
|
Create a new empty knowledge base. After creation, use [Create Document by Text](/api-reference/documents/create-document-by-text) or [Create Document by File](/api-reference/documents/create-document-by-file) to add documents.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasetCreatePayload](#datasetcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Knowledge base created successfully. | **application/json**: [DatasetDetailResponse](#datasetdetailresponse)<br> |
|
|
| 400 | Bad request - invalid parameters | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 409 | `dataset_name_duplicate` : The dataset name already exists. Please modify your dataset name. | |
|
|
|
|
### [DELETE] /datasets/{dataset_id}
|
|
**Delete Knowledge Base**
|
|
|
|
Permanently delete a knowledge base and all its documents. The knowledge base must not be in use by any application.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Success. |
|
|
| 401 | Unauthorized - invalid API token |
|
|
| 403 | Forbidden - dataset API access or workspace access denied |
|
|
| 404 | `not_found` : Dataset not found. |
|
|
| 409 | `dataset_in_use` : The knowledge base is being used by some apps. Please remove it from the apps before deleting. |
|
|
|
|
### [GET] /datasets/{dataset_id}
|
|
**Get Knowledge Base**
|
|
|
|
Retrieve detailed information about a specific knowledge base, including its embedding model, retrieval configuration, and document statistics.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Knowledge base details. | **application/json**: [DatasetDetailWithPartialMembersResponse](#datasetdetailwithpartialmembersresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `forbidden` : Insufficient permissions to access this knowledge base. | |
|
|
| 404 | `not_found` : Dataset not found. | |
|
|
|
|
### [PATCH] /datasets/{dataset_id}
|
|
**Update Knowledge Base**
|
|
|
|
Update the name, description, permissions, or retrieval settings of an existing knowledge base. Only the fields provided in the request body are updated.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasetUpdatePayload](#datasetupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Knowledge base updated successfully. | **application/json**: [DatasetDetailWithPartialMembersResponse](#datasetdetailwithpartialmembersresponse)<br> |
|
|
| 400 | Bad request - invalid embedding or reranking model configuration | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `forbidden` : Insufficient permissions to access this knowledge base. | |
|
|
| 404 | `not_found` : Dataset not found. | |
|
|
|
|
### ~~[POST] /datasets/{dataset_id}/hit-testing~~
|
|
|
|
***DEPRECATED***
|
|
|
|
**Retrieve Chunks from a Knowledge Base / Test Retrieval**
|
|
|
|
Performs a search query against a knowledge base to retrieve the most relevant chunks. This endpoint can be used for both production retrieval and test retrieval.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [HitTestingPayload](#hittestingpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Retrieval results. | **application/json**: [HitTestingResponse](#hittestingresponse)<br> |
|
|
| 400 | - `dataset_not_initialized` : The dataset is still being initialized or indexing. Please wait a moment. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `provider_quota_exceeded` : Your quota for Dify Hosted OpenAI has been exhausted. Please go to Settings -> Model Provider to complete your own provider credentials. - `model_currently_not_support` : Dify Hosted OpenAI trial currently not support the GPT-4 model. - `completion_request_error` : Completion request failed. - `invalid_param` : Invalid parameter value. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `forbidden` : Insufficient permissions. | |
|
|
| 404 | `not_found` : Knowledge base not found. | |
|
|
| 500 | `internal_server_error` : An internal error occurred during retrieval. | |
|
|
|
|
### [POST] /datasets/{dataset_id}/retrieve
|
|
**Retrieve Chunks from a Knowledge Base / Test Retrieval**
|
|
|
|
Performs a search query against a knowledge base to retrieve the most relevant chunks. This endpoint can be used for both production retrieval and test retrieval.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [HitTestingPayload](#hittestingpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Retrieval results. | **application/json**: [HitTestingResponse](#hittestingresponse)<br> |
|
|
| 400 | - `dataset_not_initialized` : The dataset is still being initialized or indexing. Please wait a moment. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `provider_quota_exceeded` : Your quota for Dify Hosted OpenAI has been exhausted. Please go to Settings -> Model Provider to complete your own provider credentials. - `model_currently_not_support` : Dify Hosted OpenAI trial currently not support the GPT-4 model. - `completion_request_error` : Completion request failed. - `invalid_param` : Invalid parameter value. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `forbidden` : Insufficient permissions. | |
|
|
| 404 | `not_found` : Knowledge base not found. | |
|
|
| 500 | `internal_server_error` : An internal error occurred during retrieval. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [POST] /datasets/pipeline/file-upload
|
|
**Upload Pipeline File**
|
|
|
|
Upload a file for use in a knowledge pipeline. Accepts a single file via `multipart/form-data`.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | File uploaded successfully. | **application/json**: [PipelineUploadFileResponse](#pipelineuploadfileresponse)<br> |
|
|
| 400 | - `no_file_uploaded` : Please upload your file. - `filename_not_exists_error` : The specified filename does not exist. - `too_many_files` : Only one file is allowed. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 413 | `file_too_large` : File size exceeded. | |
|
|
| 415 | `unsupported_file_type` : File type not allowed. | |
|
|
|
|
### [GET] /datasets/{dataset_id}/pipeline/datasource-plugins
|
|
**List Datasource Plugins**
|
|
|
|
List the datasource nodes configured in the knowledge pipeline. Each node includes the plugin it uses plus the metadata needed to run it.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| is_published | query | Whether to retrieve nodes from the published or draft pipeline. `true` returns nodes from the published version, `false` returns nodes from the draft. | No | boolean, <br>**Default:** true |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | List of datasource nodes configured in the pipeline. | **application/json**: [DatasourcePluginListResponse](#datasourcepluginlistresponse)<br> |
|
|
| 400 | Bad request - pipeline is not configured | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | `not_found` : Dataset not found. | |
|
|
|
|
### [POST] /datasets/{dataset_id}/pipeline/datasource/nodes/{node_id}/run
|
|
**Run Datasource Node**
|
|
|
|
Execute a single datasource node within the knowledge pipeline. Returns a streaming response with the node execution results.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| node_id | path | ID of the datasource node to execute. | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasourceNodeRunPayload](#datasourcenoderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Streaming response with node execution events. | **text/event-stream**: string<br> |
|
|
| 400 | Bad request - invalid payload or pipeline is not configured | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | `not_found` : Dataset not found. | |
|
|
|
|
### [POST] /datasets/{dataset_id}/pipeline/run
|
|
**Run Pipeline**
|
|
|
|
Execute the full knowledge pipeline for a knowledge base. Published runs are queued and return batch metadata as JSON. Draft runs support blocking JSON and streaming Server-Sent Events.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [PipelineRunApiEntity](#pipelinerunapientity)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Pipeline execution result. Published runs return a JSON object containing `batch`, `dataset`, and `documents`. Draft runs return `text/event-stream` for streaming mode or a workflow result JSON object for blocking mode. | **application/json**: [PipelineRunJsonResponse](#pipelinerunjsonresponse)<br>**text/event-stream**: string<br> |
|
|
| 400 | Bad request - invalid payload or pipeline is not configured | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `forbidden` : Forbidden. | |
|
|
| 404 | `not_found` : Dataset not found. | |
|
|
| 500 | `pipeline_run_error` : Pipeline execution failed. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [DELETE] /datasets/tags
|
|
**Delete Knowledge Tag**
|
|
|
|
Permanently delete a knowledge base tag. Does not delete the knowledge bases that were tagged.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TagDeletePayload](#tagdeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Success. |
|
|
| 401 | Unauthorized - invalid API token |
|
|
| 403 | Forbidden - insufficient permissions |
|
|
| 404 | Tag not found |
|
|
|
|
### [GET] /datasets/tags
|
|
**List Knowledge Tags**
|
|
|
|
Returns the list of all knowledge base tags in the workspace.
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | List of tags. | **application/json**: [KnowledgeTagListResponse](#knowledgetaglistresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
|
|
### [PATCH] /datasets/tags
|
|
**Update Knowledge Tag**
|
|
|
|
Rename an existing knowledge base tag.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TagUpdatePayload](#tagupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Tag updated successfully. | **application/json**: [KnowledgeTagResponse](#knowledgetagresponse)<br> |
|
|
| 400 | Bad request - tag name already exists | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - insufficient permissions | |
|
|
| 404 | Tag not found | |
|
|
|
|
### [POST] /datasets/tags
|
|
**Create Knowledge Tag**
|
|
|
|
Create a new tag for organizing knowledge bases.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TagCreatePayload](#tagcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Tag created successfully. | **application/json**: [KnowledgeTagResponse](#knowledgetagresponse)<br> |
|
|
| 400 | Bad request - tag name already exists | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - insufficient permissions | |
|
|
|
|
### [POST] /datasets/tags/binding
|
|
**Create Tag Binding**
|
|
|
|
Bind one or more tags to a knowledge base. A knowledge base can have multiple tags.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TagBindingPayload](#tagbindingpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Success. |
|
|
| 401 | Unauthorized - invalid API token |
|
|
| 403 | Forbidden - insufficient permissions |
|
|
| 404 | Dataset not found |
|
|
|
|
### [POST] /datasets/tags/unbinding
|
|
**Delete Tag Binding**
|
|
|
|
Remove one or more tags from a knowledge base.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TagUnbindingPayload](#tagunbindingpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Success. |
|
|
| 401 | Unauthorized - invalid API token |
|
|
| 403 | Forbidden - insufficient permissions |
|
|
| 404 | Dataset not found |
|
|
|
|
### [GET] /datasets/{dataset_id}/tags
|
|
**Get Knowledge Base Tags**
|
|
|
|
Returns the list of tags bound to a specific knowledge base.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Tags bound to the knowledge base. | **application/json**: [DatasetBoundTagListResponse](#datasetboundtaglistresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | `not_found` : Knowledge base not found. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [POST] /datasets/{dataset_id}/document/create-by-file
|
|
**Create Document by File**
|
|
|
|
Create a document by uploading a file. Supports common document formats (PDF, TXT, DOCX, etc.). Processing is asynchronous — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"data"**: string, **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document created successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)<br> |
|
|
| 400 | - `no_file_uploaded` : Please upload your file. - `too_many_files` : Only one file is allowed. - `filename_not_exists_error` : The specified filename does not exist. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, external datasets not supported, unsupported file type, missing required fields, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | `not_found` : Knowledge base not found. | |
|
|
| 413 | `file_too_large` : File size exceeded. | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
### [POST] /datasets/{dataset_id}/document/create-by-text
|
|
**Create Document by Text**
|
|
|
|
Create a document from raw text content. The document is processed asynchronously — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DocumentTextCreatePayload](#documenttextcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document created successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)<br> |
|
|
| 400 | - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist. / indexing_technique is required. / Invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | `not_found` : Knowledge base not found. | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
### ~~[POST] /datasets/{dataset_id}/document/create_by_file~~
|
|
|
|
***DEPRECATED***
|
|
|
|
**Create Document by File**
|
|
|
|
Create a document by uploading a file. Supports common document formats (PDF, TXT, DOCX, etc.). Processing is asynchronous — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"data"**: string, **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document created successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)<br> |
|
|
| 400 | - `no_file_uploaded` : Please upload your file. - `too_many_files` : Only one file is allowed. - `filename_not_exists_error` : The specified filename does not exist. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, external datasets not supported, unsupported file type, missing required fields, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | `not_found` : Knowledge base not found. | |
|
|
| 413 | `file_too_large` : File size exceeded. | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents
|
|
**List Documents**
|
|
|
|
Returns a paginated list of documents in the knowledge base. Supports filtering by keyword and indexing status.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| keyword | query | Search keyword to filter by document name. | No | string |
|
|
| limit | query | Number of items per page. Server caps at `100`. | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number to retrieve. | No | integer, <br>**Default:** 1 |
|
|
| status | query | Filter by display status. | No | string, <br>**Available values:** "archived", "available", "disabled", "error", "indexing", "paused", "queuing" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | List of documents. | **application/json**: [DocumentListResponse](#documentlistresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | `not_found` : Knowledge base not found. | |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/download-zip
|
|
**Download Documents as ZIP**
|
|
|
|
Download multiple uploaded-file documents as a single ZIP archive. Accepts up to `100` document IDs.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DocumentBatchDownloadZipPayload](#documentbatchdownloadzippayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | ZIP archive containing the requested documents. | **application/zip**: binary<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `forbidden` : Insufficient permissions. | |
|
|
| 404 | `not_found` : Document or dataset not found. | |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/documents/status/{action}
|
|
**Update Document Status in Batch**
|
|
|
|
Enable, disable, archive, or unarchive multiple documents at once.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | Action to perform: 'enable', 'disable', 'archive', or 'un_archive' | Yes | string, <br>**Available values:** "archive", "disable", "enable", "un_archive" |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DocumentStatusPayload](#documentstatuspayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document status updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 400 | `invalid_action` : Invalid action. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `forbidden` : Insufficient permissions. | |
|
|
| 404 | `not_found` : Knowledge base not found. | |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{batch}/indexing-status
|
|
**Get Document Indexing Status**
|
|
|
|
Check the indexing progress of documents in a batch. Returns the current processing stage and chunk completion counts for each document. Poll this endpoint until `indexing_status` reaches `completed` or `error`. The status progresses through: `waiting` → `parsing` → `cleaning` → `splitting` → `indexing` → `completed`.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| batch | path | Batch ID. | Yes | string |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Indexing status for documents in the batch. | **application/json**: [DocumentStatusListResponse](#documentstatuslistresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | `not_found` : Knowledge base not found. / Documents not found. | |
|
|
|
|
### [DELETE] /datasets/{dataset_id}/documents/{document_id}
|
|
**Delete Document**
|
|
|
|
Permanently delete a document and all its chunks from the knowledge base.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Success. |
|
|
| 400 | `document_indexing` : Cannot delete document during indexing. |
|
|
| 401 | Unauthorized - invalid API token |
|
|
| 403 | `archived_document_immutable` : The archived document is not editable. |
|
|
| 404 | `not_found` : Document Not Exists. |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}
|
|
**Get Document**
|
|
|
|
Retrieve detailed information about a specific document, including its indexing status, metadata, and processing statistics.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
| metadata | query | `all` returns all fields including metadata. `only` returns only `id`, `doc_type`, and `doc_metadata`. `without` returns all fields except `doc_metadata`. | No | string, <br>**Available values:** "all", "only", "without", <br>**Default:** all |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document details. The response shape varies based on the `metadata` query parameter. When `metadata` is `only`, only `id`, `doc_type`, and `doc_metadata` are returned. When `metadata` is `without`, `doc_type` and `doc_metadata` are omitted. | **application/json**: [DocumentDetailResponse](#documentdetailresponse)<br> |
|
|
| 400 | `invalid_metadata` : Invalid metadata value for the specified key. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `forbidden` : No permission. | |
|
|
| 404 | `not_found` : Document not found. | |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/documents/{document_id}
|
|
**Update Document by File**
|
|
|
|
Update an existing document by uploading a new file. Re-triggers indexing — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| No | **multipart/form-data**: { **"data"**: string, **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document updated successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)<br> |
|
|
| 400 | - `too_many_files` : Only one file is allowed. - `filename_not_exists_error` : The specified filename does not exist. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, external datasets not supported, unsupported file type, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Document not found | |
|
|
| 413 | `file_too_large` : File size exceeded. | |
|
|
| 415 | Unsupported file type | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/download
|
|
**Download Document**
|
|
|
|
Get a signed download URL for a document's original uploaded file.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Download URL generated successfully. | **application/json**: [UrlResponse](#urlresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `forbidden` : No permission to access this document. | |
|
|
| 404 | `not_found` : Document not found. | |
|
|
|
|
### ~~[POST] /datasets/{dataset_id}/documents/{document_id}/update-by-file~~
|
|
|
|
***DEPRECATED***
|
|
|
|
**Update Document by File**
|
|
|
|
Update an existing document by uploading a new file. Re-triggers indexing — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| No | **multipart/form-data**: { **"data"**: string, **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document updated successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)<br> |
|
|
| 400 | - `too_many_files` : Only one file is allowed. - `filename_not_exists_error` : The specified filename does not exist. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, external datasets not supported, unsupported file type, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Document not found | |
|
|
| 413 | `file_too_large` : File size exceeded. | |
|
|
| 415 | Unsupported file type | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/{document_id}/update-by-text
|
|
**Update Document by Text**
|
|
|
|
Update an existing document's text content, name, or processing configuration. Re-triggers indexing if content changes — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DocumentTextUpdate](#documenttextupdate)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document updated successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)<br> |
|
|
| 400 | - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, name is required when text is provided, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Document not found | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
### ~~[POST] /datasets/{dataset_id}/documents/{document_id}/update_by_file~~
|
|
|
|
***DEPRECATED***
|
|
|
|
**Update Document by File**
|
|
|
|
Update an existing document by uploading a new file. Re-triggers indexing — use the returned `batch` ID with [Get Document Indexing Status](/api-reference/documents/get-document-indexing-status) to track progress.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| No | **multipart/form-data**: { **"data"**: string, **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document updated successfully. | **application/json**: [DocumentAndBatchResponse](#documentandbatchresponse)<br> |
|
|
| 400 | - `too_many_files` : Only one file is allowed. - `filename_not_exists_error` : The specified filename does not exist. - `provider_not_initialize` : No valid model provider credentials found. Please go to Settings -> Model Provider to complete your provider credentials. - `invalid_param` : Knowledge base does not exist, external datasets not supported, unsupported file type, or invalid doc_form (must be `text_model`, `hierarchical_model`, or `qa_model`). | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Document not found | |
|
|
| 413 | `file_too_large` : File size exceeded. | |
|
|
| 415 | Unsupported file type | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/metadata
|
|
**Update Document Metadata in Batch**
|
|
|
|
Update metadata values for multiple documents at once. Each document in the request receives the specified metadata key-value pairs.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MetadataOperationData](#metadataoperationdata)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document metadata updated successfully. | **application/json**: [DatasetMetadataActionResponse](#datasetmetadataactionresponse)<br> |
|
|
| 400 | Bad request - invalid or conflicting document metadata operation | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Dataset, document, or metadata not found | |
|
|
|
|
### [GET] /datasets/{dataset_id}/metadata
|
|
**List Metadata Fields**
|
|
|
|
Returns the list of all metadata fields (both custom and built-in) for the knowledge base, along with the count of documents using each field.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Metadata fields for the knowledge base. | **application/json**: [DatasetMetadataListResponse](#datasetmetadatalistresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Dataset not found | |
|
|
|
|
### [POST] /datasets/{dataset_id}/metadata
|
|
**Create Metadata Field**
|
|
|
|
Create a custom metadata field for the knowledge base. Metadata fields can be used to annotate documents with structured information.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MetadataArgs](#metadataargs)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Metadata field created successfully. | **application/json**: [DatasetMetadataResponse](#datasetmetadataresponse)<br> |
|
|
| 400 | Bad request - invalid or duplicate metadata name | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Dataset not found | |
|
|
|
|
### [GET] /datasets/{dataset_id}/metadata/built-in
|
|
**Get Built-in Metadata Fields**
|
|
|
|
Returns the list of built-in metadata fields provided by the system (e.g., document type, source URL).
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Built-in metadata fields. | **application/json**: [DatasetMetadataBuiltInFieldsResponse](#datasetmetadatabuiltinfieldsresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | `not_found` : Knowledge base not found. | |
|
|
|
|
### [POST] /datasets/{dataset_id}/metadata/built-in/{action}
|
|
**Update Built-in Metadata Field**
|
|
|
|
Enable or disable built-in metadata fields for the knowledge base.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | `enable` to activate built-in metadata fields, `disable` to deactivate them. | Yes | string, <br>**Available values:** "disable", "enable" |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Built-in metadata field toggled successfully. | **application/json**: [DatasetMetadataActionResponse](#datasetmetadataactionresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Dataset not found | |
|
|
|
|
### [DELETE] /datasets/{dataset_id}/metadata/{metadata_id}
|
|
**Delete Metadata Field**
|
|
|
|
Permanently delete a custom metadata field. Documents using this field will lose their metadata values for it.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| metadata_id | path | Metadata field ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Success. |
|
|
| 401 | Unauthorized - invalid API token |
|
|
| 403 | Forbidden - dataset API access or workspace access denied |
|
|
| 404 | Dataset or metadata not found |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/metadata/{metadata_id}
|
|
**Update Metadata Field**
|
|
|
|
Rename a custom metadata field.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| metadata_id | path | Metadata field ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MetadataUpdatePayload](#metadataupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Metadata field updated successfully. | **application/json**: [DatasetMetadataResponse](#datasetmetadataresponse)<br> |
|
|
| 400 | Bad request - invalid or duplicate metadata name | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Dataset or metadata not found | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/segments
|
|
**List Chunks**
|
|
|
|
Returns a paginated list of chunks within a document. Supports filtering by keyword and status.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
| keyword | query | Search keyword. | No | string |
|
|
| limit | query | Number of items per page. Server caps at `100`. | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number to retrieve. | No | integer, <br>**Default:** 1 |
|
|
| status | query | Filter chunks by indexing status, such as `completed`, `indexing`, or `error`. | No | [ string ] |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | List of chunks. | **application/json**: [SegmentListResponse](#segmentlistresponse)<br> |
|
|
| 400 | Bad request - embedding model is not configured | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Dataset or document not found | |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/{document_id}/segments
|
|
**Create Chunks**
|
|
|
|
Create one or more chunks within a document. Each chunk can include optional keywords and an answer field (for QA-mode documents).
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SegmentCreatePayload](#segmentcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Chunks created successfully. | **application/json**: [SegmentCreateListResponse](#segmentcreatelistresponse)<br> |
|
|
| 400 | Bad request - segments data is missing | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | `not_found` : Document is not completed or is disabled. | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
### [DELETE] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}
|
|
**Delete Chunk**
|
|
|
|
Permanently delete a chunk from the document.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
| segment_id | path | Chunk ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Success. |
|
|
| 400 | Bad request - invalid dataset model state or concurrent deletion |
|
|
| 401 | Unauthorized - invalid API token |
|
|
| 403 | Forbidden - dataset API access or workspace access denied |
|
|
| 404 | Dataset, document, or segment not found |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}
|
|
**Get Chunk**
|
|
|
|
Retrieve detailed information about a specific chunk, including its content, keywords, and indexing status.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
| segment_id | path | Chunk ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Chunk details. | **application/json**: [SegmentDetailResponse](#segmentdetailresponse)<br> |
|
|
| 400 | Bad request - invalid dataset model configuration | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Dataset, document, or segment not found | |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}
|
|
**Update Chunk**
|
|
|
|
Update a chunk's content, keywords, or answer. Re-triggers indexing for the modified chunk.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
| segment_id | path | Chunk ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SegmentUpdatePayload](#segmentupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Chunk updated successfully. | **application/json**: [SegmentDetailResponse](#segmentdetailresponse)<br> |
|
|
| 400 | Bad request - invalid segment or embedding model configuration | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Dataset, document, or segment not found | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks
|
|
**List Child Chunks**
|
|
|
|
Returns a paginated list of child chunks under a specific parent chunk.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
| segment_id | path | Chunk ID. | Yes | string (uuid) |
|
|
| keyword | query | Search keyword. | No | string |
|
|
| limit | query | Number of items per page. Server caps at `100`. | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number to retrieve. | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | List of child chunks. | **application/json**: [ChildChunkListResponse](#childchunklistresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Dataset, document, or segment not found | |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks
|
|
**Create Child Chunk**
|
|
|
|
Create a child chunk under the specified segment.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
| segment_id | path | Chunk ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChildChunkCreatePayload](#childchunkcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Child chunk created successfully. | **application/json**: [ChildChunkDetailResponse](#childchunkdetailresponse)<br> |
|
|
| 400 | `invalid_param` : Create child chunk index failed. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Dataset, document, or segment not found | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
### [DELETE] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks/{child_chunk_id}
|
|
**Delete Child Chunk**
|
|
|
|
Permanently delete a child chunk from its parent chunk.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| child_chunk_id | path | Child chunk ID. | Yes | string (uuid) |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
| segment_id | path | Chunk ID. | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Success. |
|
|
| 400 | `invalid_param` : Delete child chunk index failed. |
|
|
| 401 | Unauthorized - invalid API token |
|
|
| 403 | Forbidden - dataset API access or workspace access denied |
|
|
| 404 | Dataset, document, segment, or child chunk not found |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks/{child_chunk_id}
|
|
**Update Child Chunk**
|
|
|
|
Update the content of an existing child chunk.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| child_chunk_id | path | Child chunk ID. | Yes | string (uuid) |
|
|
| dataset_id | path | Knowledge base ID. | Yes | string (uuid) |
|
|
| document_id | path | Document ID. | Yes | string (uuid) |
|
|
| segment_id | path | Chunk ID. | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChildChunkUpdatePayload](#childchunkupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Child chunk updated successfully. | **application/json**: [ChildChunkDetailResponse](#childchunkdetailresponse)<br> |
|
|
| 400 | `invalid_param` : Update child chunk index failed. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - dataset API access or workspace access denied | |
|
|
| 404 | Dataset, document, segment, or child chunk not found | |
|
|
| 503 | `service_unavailable` : Vector space usage could not be verified. Returned on the Dify Cloud Sandbox plan only; retry the request later. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [GET] /end-users/{end_user_id}
|
|
**Get End User Info**
|
|
|
|
Retrieve an end user by ID. Useful when other APIs return an end-user ID (e.g., `created_by` from [Upload File](/api-reference/files/upload-file)).
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| end_user_id | path | End user ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | End user retrieved successfully. | **application/json**: [EndUserDetail](#enduserdetail)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `end_user_not_found` : End user not found. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [POST] /files/upload
|
|
**Upload File**
|
|
|
|
Upload a file for use when sending messages, enabling multimodal understanding of images, documents, audio, and video. Uploaded files are for use by the current end-user only.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary, **"user"**: string }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | File uploaded successfully. | **application/json**: [FileResponse](#fileresponse)<br> |
|
|
| 400 | - `no_file_uploaded` : No file was provided in the request. - `too_many_files` : Only one file is allowed per request. - `filename_not_exists_error` : The uploaded file has no filename. - `file_extension_blocked` : The file extension is blocked for security reasons. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 413 | `file_too_large` : File size exceeded. | |
|
|
| 415 | `unsupported_file_type` : File type not allowed. | |
|
|
|
|
### [GET] /files/{file_id}/preview
|
|
**Download File**
|
|
|
|
Preview or download uploaded files previously uploaded via the [Upload File](/api-reference/files/upload-file) API. Files can only be accessed if they belong to messages within the requesting application.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| file_id | path | The unique identifier of the file to preview, obtained from the [Upload File](/api-reference/files/upload-file) API response. | Yes | string (uuid) |
|
|
| as_attachment | query | If `true`, forces the file to download as an attachment instead of previewing in browser. | No | boolean |
|
|
| user | query | User identifier, used for end-user context. | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Returns the raw file content. The `Content-Type` header is set to the file's MIME type. If `as_attachment` is `true`, the file is returned as a download with `Content-Disposition: attachment`. | `*/*`: binary<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `file_access_denied` : Access to the requested file is denied. | |
|
|
| 404 | `file_not_found` : The requested file was not found. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [GET] /form/human_input/{form_token}
|
|
**Get Human Input Form**
|
|
|
|
Retrieve a paused Human Input form's contents using the `form_token` from a `human_input_required` event. Requires **WebApp** delivery.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| form_token | path | Human input form token | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Form contents retrieved successfully. | **application/json**: [HumanInputFormDefinitionResponse](#humaninputformdefinitionresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Form not found. | |
|
|
| 412 | - `human_input_form_submitted` : Form already submitted. Forms are one-shot; the first response wins regardless of which user submits it. - `human_input_form_expired` : The form's expiration time passed before submission arrived. | |
|
|
|
|
### [POST] /form/human_input/{form_token}
|
|
**Submit Human Input Form**
|
|
|
|
Submit the recipient's response to a paused Human Input form. The workflow resumes on acceptance; use [Stream Workflow Events](/api-reference/chatflows/stream-workflow-events) to follow subsequent events. Requires **WebApp** delivery.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| form_token | path | Human input form token | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [HumanInputFormSubmitPayloadWithUser](#humaninputformsubmitpayloadwithuser)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Form submitted successfully. The response body is an empty object. | **application/json**: [HumanInputFormSubmitResponse](#humaninputformsubmitresponse)<br> |
|
|
| 400 | - `bad_request` : Form recipient type is invalid. - `invalid_form_data` : Submission failed validation against the form definition. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Form not found. | |
|
|
| 412 | - `human_input_form_submitted` : Form already submitted. Forms are one-shot; the first response wins regardless of which user submits it. - `human_input_form_expired` : The form's expiration time passed before submission arrived. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [GET] /info
|
|
**Get App Info**
|
|
|
|
Retrieve basic information about this application, including name, description, tags, and mode.
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Basic information of the application. | **application/json**: [AppInfoResponse](#appinforesponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | Application not found | |
|
|
|
|
### [GET] /meta
|
|
**Get App Meta**
|
|
|
|
Retrieve metadata about this application, including tool icons and other configuration details.
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successfully retrieved application meta information. | **application/json**: [AppMetaResponse](#appmetaresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | Application not found | |
|
|
|
|
### [GET] /parameters
|
|
**Get App Parameters**
|
|
|
|
Retrieve the application's input form configuration, including feature switches, input parameter names, types, and default values.
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Application parameters information. | **application/json**: [Parameters](#parameters)<br> |
|
|
| 400 | `app_unavailable` : App unavailable or misconfigured. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | Application not found | |
|
|
|
|
### [GET] /site
|
|
**Get App WebApp Settings**
|
|
|
|
Retrieve the WebApp settings of this application, including site configuration, theme, and customization options.
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | WebApp settings of the application. | **application/json**: [Site](#site)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | `forbidden` : Site not found for this application or the workspace has been archived. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [GET] /workflow/{workflow_run_id}/events
|
|
**Stream Workflow Events**
|
|
|
|
Resume the Server-Sent Events stream for a workflow run after a pause or a dropped SSE connection. For runs that have already finished, the stream emits a single `workflow_finished` event and closes.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| workflow_run_id | path | Workflow run ID returned by the original workflow run request. | Yes | string |
|
|
| continue_on_pause | query | Set to `true` to keep the stream open across multiple `workflow_paused` events, which is useful when the workflow has more than one Human Input node in sequence. By default, the stream closes after the first pause. | No | boolean |
|
|
| include_state_snapshot | query | When `true`, replay from the persisted state snapshot to include a status summary of already-executed nodes before streaming new events. | No | boolean |
|
|
| user | query | End-user identifier that originally triggered the run. Must match the creator of the run. | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Server-Sent Events stream. Each event is delivered as `data: {JSON}\\n\\n`. Event payloads follow the same schemas as the original streaming response. | **text/event-stream**: string<br> |
|
|
| 400 | `not_workflow_app` : Please check if your app mode matches the right API route. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Workflow run not found. | |
|
|
|
|
### [GET] /workflows/logs
|
|
**List Workflow Logs**
|
|
|
|
Retrieve paginated workflow execution logs with filtering options.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| created_at__after | query | Filter logs created after this ISO 8601 timestamp. | No | dateTime |
|
|
| created_at__before | query | Filter logs created before this ISO 8601 timestamp. | No | dateTime |
|
|
| created_by_account | query | Filter by account ID. | No | string |
|
|
| created_by_end_user_session_id | query | Filter by end user session ID. | No | string |
|
|
| keyword | query | Keyword to search in logs. | No | string |
|
|
| limit | query | Number of items per page. | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number for pagination. | No | integer, <br>**Default:** 1 |
|
|
| status | query | Filter by execution status. | No | string, <br>**Available values:** "failed", "stopped", "succeeded" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successfully retrieved workflow logs. | **application/json**: [WorkflowAppLogPaginationResponse](#workflowapplogpaginationresponse)<br> |
|
|
| 400 | Bad request - invalid query parameters | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
|
|
### [POST] /workflows/run
|
|
**Run Workflow**
|
|
|
|
Execute a workflow. Cannot be executed without a published workflow.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowRunPayloadWithUser](#workflowrunpayloadwithuser)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successful response. The content type and structure depend on the `response_mode` parameter in the request. - If `response_mode` is `blocking`, returns `application/json` with a `WorkflowBlockingResponse` object. - If `response_mode` is `streaming`, returns `text/event-stream` with a stream of `ChunkWorkflowEvent` objects. | **application/json**: [WorkflowBlockingResponse](#workflowblockingresponse)<br>**text/event-stream**: string<br> |
|
|
| 400 | - `not_workflow_app` : App mode does not match the API route. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model unavailable. - `completion_request_error` : Workflow execution request failed. - `invalid_param` : Invalid parameter value. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | - `forbidden` : Token scope, app, or workspace access denied. - `trigger_workflow_service_mode_unavailable` : Trigger-entry workflows cannot be invoked through Web App, Service API, OpenAPI, or MCP. | |
|
|
| 404 | Workflow not found | |
|
|
| 429 | - `too_many_requests` : Too many concurrent requests for this app. - `rate_limit_error` : The upstream model provider rate limit was exceeded. | |
|
|
| 500 | `internal_server_error` : Internal server error. | |
|
|
|
|
### [GET] /workflows/run/{workflow_run_id}
|
|
**Get Workflow Run Detail**
|
|
|
|
Retrieve the current execution results of a workflow task based on the workflow execution ID.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| workflow_run_id | path | Workflow run ID, obtained from the workflow execution response or streaming events. | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successfully retrieved workflow run details. | **application/json**: [WorkflowRunResponse](#workflowrunresponse)<br> |
|
|
| 400 | `not_workflow_app` : App mode does not match the API route. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
| 404 | `not_found` : Workflow run not found. | |
|
|
|
|
### [POST] /workflows/tasks/{task_id}/stop
|
|
**Stop Workflow Task**
|
|
|
|
Stop a running workflow task. Only supported in `streaming` mode.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| task_id | path | Task ID, obtained from the streaming chunk returned by the Run Workflow API. | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowTaskStopPayload](#workflowtaskstoppayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 400 | - `not_workflow_app` : App mode does not match the API route. - `invalid_param` : Required parameter missing or invalid. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | Forbidden - token scope, app, dataset, or workspace access denied | |
|
|
|
|
### [POST] /workflows/{workflow_id}/run
|
|
**Run Workflow by ID**
|
|
|
|
Execute a specific workflow version identified by its ID. Useful for running a particular published version of the workflow.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| workflow_id | path | Workflow ID of the specific version to execute. This value is returned in the `workflow_id` field of workflow run responses. | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowRunPayloadWithUser](#workflowrunpayloadwithuser)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Successful response. The content type and structure depend on the `response_mode` parameter in the request. - If `response_mode` is `blocking`, returns `application/json` with a `WorkflowBlockingResponse` object. - If `response_mode` is `streaming`, returns `text/event-stream` with a stream of `ChunkWorkflowEvent` objects. | **application/json**: [WorkflowBlockingResponse](#workflowblockingresponse)<br>**text/event-stream**: string<br> |
|
|
| 400 | - `not_workflow_app` : App mode does not match the API route. - `bad_request` : Workflow is a draft or has an invalid ID format. - `provider_not_initialize` : No valid model provider credentials found. - `provider_quota_exceeded` : Model provider quota exhausted. - `model_currently_not_support` : Current model unavailable. - `completion_request_error` : Workflow execution request failed. - `invalid_param` : Required parameter missing or invalid. | |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
| 403 | - `forbidden` : Token scope, app, or workspace access denied. - `workflow_version_execution_not_allowed` : Workflow version execution is unavailable on the current plan. Upgrade to a paid plan. - `trigger_workflow_service_mode_unavailable` : The selected workflow version uses a trigger entry and cannot be invoked through Web App, Service API, OpenAPI, or MCP. | |
|
|
| 404 | `not_found` : Workflow not found. | |
|
|
| 429 | - `too_many_requests` : Too many concurrent requests for this app. - `rate_limit_error` : The upstream model provider rate limit was exceeded. | |
|
|
| 500 | `internal_server_error` : Internal server error. | |
|
|
|
|
---
|
|
## default
|
|
|
|
### [GET] /workspaces/current/models/model-types/{model_type}
|
|
**Get Available Models**
|
|
|
|
Retrieve the list of available models by type. Primarily used to query `text-embedding` and `rerank` models for knowledge base configuration.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| model_type | path | Type of model to retrieve. | Yes | string, <br>**Available values:** "llm", "moderation", "rerank", "speech2text", "text-embedding", "tts" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Available models for the specified type. | **application/json**: [ProviderWithModelsListResponse](#providerwithmodelslistresponse)<br> |
|
|
| 401 | Unauthorized - invalid API token | |
|
|
|
|
---
|
|
### Schemas
|
|
|
|
#### AgentThought
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | No |
|
|
| chain_id | string | | No |
|
|
| created_at | integer | | No |
|
|
| files | [ string ] | | Yes |
|
|
| id | string | | Yes |
|
|
| message_id | string | | Yes |
|
|
| observation | string | | No |
|
|
| position | integer | | Yes |
|
|
| thought | string | | No |
|
|
| tool | string | | No |
|
|
| tool_input | string | | No |
|
|
| tool_labels | [JSONValue](#jsonvalue) | Labels for tools used. | Yes |
|
|
|
|
#### Annotation
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | No |
|
|
| created_at | integer | | No |
|
|
| hit_count | integer | | No |
|
|
| id | string (uuid) | | Yes |
|
|
| question | string | | No |
|
|
|
|
#### AnnotationCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | Annotation answer. | Yes |
|
|
| question | string | Annotation question. | Yes |
|
|
|
|
#### AnnotationJobStatusDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| error_msg | string | | No |
|
|
| job_id | string (uuid) | | Yes |
|
|
| job_status | string | | Yes |
|
|
|
|
#### AnnotationJobStatusResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| job_id | string (uuid) | | Yes |
|
|
| job_status | string | | Yes |
|
|
|
|
#### AnnotationList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [Annotation](#annotation) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### AnnotationListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword | string | Keyword to filter annotations by question or answer content. | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of items per page. | No |
|
|
| page | integer, <br>**Default:** 1 | Page number for pagination. | No |
|
|
|
|
#### AnnotationReplyActionPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding_model_name | string | Name of the embedding model to use for annotation matching. | Yes |
|
|
| embedding_provider_name | string | Name of the embedding model provider. | Yes |
|
|
| score_threshold | float | Minimum similarity score for an annotation to be considered a match. Higher values require closer matches. | Yes |
|
|
|
|
#### AppFeedbackListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AppFeedbackResponse](#appfeedbackresponse) ] | | Yes |
|
|
|
|
#### AppFeedbackResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string (uuid) | | Yes |
|
|
| content | string | | No |
|
|
| conversation_id | string (uuid) | | Yes |
|
|
| created_at | string | | Yes |
|
|
| from_account_id | string | | No |
|
|
| from_end_user_id | string | | No |
|
|
| from_source | string | | Yes |
|
|
| id | string (uuid) | | Yes |
|
|
| message_id | string (uuid) | | Yes |
|
|
| rating | string | | Yes |
|
|
| updated_at | string | | Yes |
|
|
|
|
#### AppInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author_name | string | | Yes |
|
|
| description | string | | Yes |
|
|
| mode | string | | Yes |
|
|
| name | string | | Yes |
|
|
| tags | [ string ] | | Yes |
|
|
|
|
#### AppMetaResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| tool_icons | object | | No |
|
|
|
|
#### AudioBinaryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AudioBinaryResponse | string | | |
|
|
|
|
#### AudioTranscriptResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| text | string | | Yes |
|
|
|
|
#### BinaryFileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| BinaryFileResponse | string | | |
|
|
|
|
#### BlockingMetadataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| retriever_resources | [ [BlockingRetrieverResourceResponse](#blockingretrieverresourceresponse) ] | | No |
|
|
| usage | [BlockingUsageResponse](#blockingusageresponse) | | No |
|
|
|
|
#### BlockingRetrieverResourceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | No |
|
|
| created_at | integer | | No |
|
|
| data_source_type | string | | No |
|
|
| dataset_id | string | | No |
|
|
| dataset_name | string | | No |
|
|
| document_id | string | | No |
|
|
| document_name | string | | No |
|
|
| hit_count | integer | | No |
|
|
| id | string | | No |
|
|
| index_node_hash | string | | No |
|
|
| message_id | string | | No |
|
|
| position | integer | | Yes |
|
|
| score | number | | No |
|
|
| segment_id | string | | No |
|
|
| segment_position | integer | | No |
|
|
| summary | string | | No |
|
|
| word_count | integer | | No |
|
|
|
|
#### BlockingUsageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completion_price | string | | No |
|
|
| completion_price_unit | string | | No |
|
|
| completion_tokens | integer | | No |
|
|
| completion_unit_price | string | | No |
|
|
| currency | string | | No |
|
|
| latency | number | | No |
|
|
| prompt_price | string | | No |
|
|
| prompt_price_unit | string | | No |
|
|
| prompt_tokens | integer | | No |
|
|
| prompt_unit_price | string | | No |
|
|
| total_price | string | | No |
|
|
| total_tokens | integer | | No |
|
|
|
|
#### ButtonStyle
|
|
|
|
Button styles for user actions.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ButtonStyle | string | Button styles for user actions. | |
|
|
|
|
#### ChatBlockingResponse
|
|
|
|
Blocking chat response for a completed message or paused Chatflow.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ChatBlockingResponse | [ChatMessageBlockingResponse](#chatmessageblockingresponse)<br>[ChatPausedBlockingResponse](#chatpausedblockingresponse) | Blocking chat response for a completed message or paused Chatflow. | |
|
|
|
|
#### ChatMessageBlockingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| conversation_id | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| event | string | | Yes |
|
|
| id | string | | Yes |
|
|
| message_id | string | | Yes |
|
|
| metadata | [BlockingMetadataResponse](#blockingmetadataresponse) | Metadata including usage and retriever resources. | Yes |
|
|
| mode | string | | Yes |
|
|
| task_id | string | | Yes |
|
|
|
|
#### ChatPauseReasonResponse
|
|
|
|
Public pause reason emitted by a blocking Chatflow execution.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TYPE | string | | Yes |
|
|
| actions | [ [JSONObject](#jsonobject) ] | | No |
|
|
| approval_channels | [ string ] | | No |
|
|
| display_in_ui | boolean | | No |
|
|
| expiration_time | integer | | No |
|
|
| form_content | string | | No |
|
|
| form_id | string | | No |
|
|
| form_token | string | | No |
|
|
| inputs | [ [JSONObject](#jsonobject) ] | | No |
|
|
| message | string | | No |
|
|
| node_id | string | | No |
|
|
| node_title | string | | No |
|
|
| resolved_default_values | object | | No |
|
|
|
|
#### ChatPausedBlockingDataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| conversation_id | string (uuid) | | Yes |
|
|
| created_at | long | | Yes |
|
|
| elapsed_time | float | | Yes |
|
|
| id | string (uuid) | | Yes |
|
|
| message_id | string (uuid) | | Yes |
|
|
| metadata | [BlockingMetadataResponse](#blockingmetadataresponse) | Metadata including usage and retriever resources. | Yes |
|
|
| mode | string | | Yes |
|
|
| paused_nodes | [ string ] | | Yes |
|
|
| reasons | [ [ChatPauseReasonResponse](#chatpausereasonresponse) ] | | Yes |
|
|
| status | string | | Yes |
|
|
| total_steps | integer | | Yes |
|
|
| total_tokens | integer | | Yes |
|
|
| workflow_run_id | string (uuid) | | Yes |
|
|
|
|
#### ChatPausedBlockingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| conversation_id | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| data | [ChatPausedBlockingDataResponse](#chatpausedblockingdataresponse) | | Yes |
|
|
| event | string | | Yes |
|
|
| id | string | | Yes |
|
|
| message_id | string | | Yes |
|
|
| metadata | [BlockingMetadataResponse](#blockingmetadataresponse) | Metadata including usage and retriever resources. | Yes |
|
|
| mode | string | | Yes |
|
|
| task_id | string | | Yes |
|
|
| workflow_run_id | string | | Yes |
|
|
|
|
#### ChatRequestPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| auto_generate_name | boolean, <br>**Default:** true | Auto-generate the conversation title. If `false`, use the Rename Conversation API with `auto_generate: true` to generate the title asynchronously. | No |
|
|
| conversation_id | string | Conversation ID to continue a conversation. Omit this field or pass an empty string to start a new conversation, then pass the returned `conversation_id` in subsequent requests. | No |
|
|
| files | [ object<br>object<br>object<br>object ] | File list for multimodal understanding, including images, documents, audio, and video. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No |
|
|
| inputs | object | Values for app-defined variables. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover expected variable names and types. | Yes |
|
|
| query | string | User input or question content. | Yes |
|
|
| response_mode | string, <br>**Available values:** "blocking", "streaming" | Response mode. `streaming` uses Server-Sent Events; `blocking` returns after completion. New Agent app mode supports streaming only. When omitted, non-Agent apps run in blocking mode and new Agent apps stream. | No |
|
|
| workflow_id | string | Published workflow version ID to execute for advanced chat. If omitted, the app's current published workflow is used. | No |
|
|
|
|
#### ChatRequestPayloadWithUser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| auto_generate_name | boolean, <br>**Default:** true | Auto-generate the conversation title. If `false`, use the Rename Conversation API with `auto_generate: true` to generate the title asynchronously. | No |
|
|
| conversation_id | string | Conversation ID to continue a conversation. Omit this field or pass an empty string to start a new conversation, then pass the returned `conversation_id` in subsequent requests. | No |
|
|
| files | [ object<br>object<br>object<br>object ] | File list for multimodal understanding, including images, documents, audio, and video. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No |
|
|
| inputs | object | Values for app-defined variables. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover expected variable names and types. | Yes |
|
|
| query | string | User input or question content. | Yes |
|
|
| response_mode | string, <br>**Available values:** "blocking", "streaming" | Response mode. `streaming` uses Server-Sent Events; `blocking` returns after completion. New Agent app mode supports streaming only. When omitted, non-Agent apps run in blocking mode and new Agent apps stream. | No |
|
|
| user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | Yes |
|
|
| workflow_id | string | Published workflow version ID to execute for advanced chat. If omitted, the app's current published workflow is used. | No |
|
|
|
|
#### ChildChunkCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | Child chunk text content. | Yes |
|
|
|
|
#### ChildChunkDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ChildChunkResponse](#childchunkresponse) | | Yes |
|
|
|
|
#### ChildChunkListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword | string | Search keyword. | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of items per page. Server caps at `100`. | No |
|
|
| page | integer, <br>**Default:** 1 | Page number to retrieve. | No |
|
|
|
|
#### ChildChunkListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ChildChunkResponse](#childchunkresponse) ] | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
| total_pages | integer | | Yes |
|
|
|
|
#### ChildChunkResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| position | integer | | Yes |
|
|
| segment_id | string | | Yes |
|
|
| type | string | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| word_count | integer | | Yes |
|
|
|
|
#### ChildChunkUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | Child chunk text content. | Yes |
|
|
|
|
#### CompletionBlockingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| created_at | long | | Yes |
|
|
| event | string | | Yes |
|
|
| id | string (uuid) | | Yes |
|
|
| message_id | string (uuid) | | Yes |
|
|
| metadata | [BlockingMetadataResponse](#blockingmetadataresponse) | Metadata including usage and retriever resources. | Yes |
|
|
| mode | string | | Yes |
|
|
| task_id | string (uuid) | | Yes |
|
|
|
|
#### CompletionRequestPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object<br>object<br>object<br>object ] | File list for multimodal understanding, including images, documents, audio, and video. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No |
|
|
| inputs | object | Values for app-defined variables. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover expected variable names and types. | Yes |
|
|
| query | string | User input or prompt content. | No |
|
|
| response_mode | string, <br>**Available values:** "blocking", "streaming" | Response mode. `streaming` uses Server-Sent Events; `blocking` returns after completion. When omitted, the request runs in blocking mode. | No |
|
|
|
|
#### CompletionRequestPayloadWithUser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object<br>object<br>object<br>object ] | File list for multimodal understanding, including images, documents, audio, and video. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No |
|
|
| inputs | object | Values for app-defined variables. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover expected variable names and types. | Yes |
|
|
| query | string | User input or prompt content. | No |
|
|
| response_mode | string, <br>**Available values:** "blocking", "streaming" | Response mode. `streaming` uses Server-Sent Events; `blocking` returns after completion. When omitted, the request runs in blocking mode. | No |
|
|
| user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | Yes |
|
|
|
|
#### Condition
|
|
|
|
Condition detail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| comparison_operator | string, <br>**Available values:** "<", "=", ">", "after", "before", "contains", "empty", "end with", "in", "is", "is not", "not contains", "not empty", "not in", "start with", "≠", "≤", "≥" | Comparison to apply. String operators (`contains`, `not contains`, `start with`, `end with`, `is`, `is not`, `empty`, `not empty`, `in`, `not in`) act on string or array metadata; numeric operators (`=`, `≠`, `>`, `<`, `≥`, `≤`) act on numeric metadata; time operators (`before`, `after`) act on time metadata.<br>*Enum:* `"<"`, `"="`, `">"`, `"after"`, `"before"`, `"contains"`, `"empty"`, `"end with"`, `"in"`, `"is"`, `"is not"`, `"not contains"`, `"not empty"`, `"not in"`, `"start with"`, `"≠"`, `"≤"`, `"≥"` | Yes |
|
|
| name | string | Metadata field name to compare against. | Yes |
|
|
| value | string<br>[ string ]<br>number | Value to compare against. Type depends on `comparison_operator`: string for most string operators, array of strings for `in` and `not in`, number for numeric operators, and omit or use `null` for `empty` and `not empty`. | No |
|
|
|
|
#### ConversationInfiniteScrollPagination
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [SimpleConversation](#simpleconversation) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
|
|
#### ConversationListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| last_id | string | The ID of the last record on the current page. Used to fetch the next page. | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of records to return. | No |
|
|
| sort_by | string, <br>**Available values:** "-created_at", "-updated_at", "created_at", "updated_at", <br>**Default:** -updated_at | Sorting field. Use the `-` prefix for descending order.<br>*Enum:* `"-created_at"`, `"-updated_at"`, `"created_at"`, `"updated_at"` | No |
|
|
|
|
#### ConversationRenamePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| auto_generate | boolean | Automatically generate the conversation name. When `true`, the `name` field is ignored. | No |
|
|
| name | string | Conversation name. Required when `auto_generate` is `false`. | No |
|
|
|
|
#### ConversationRenamePayloadWithUser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| auto_generate | boolean | Automatically generate the conversation name. When `true`, the `name` field is ignored. | No |
|
|
| name | string | Conversation name. Required when `auto_generate` is `false`. | No |
|
|
| user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | No |
|
|
|
|
#### ConversationVariableInfiniteScrollPaginationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ConversationVariableResponse](#conversationvariableresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
|
|
#### ConversationVariableResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| description | string | | No |
|
|
| id | string (uuid) | | Yes |
|
|
| name | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
| value | string | | No |
|
|
| value_type | string | | Yes |
|
|
|
|
#### ConversationVariableUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| value | | The new value for the variable. Must match the variable's expected type. | Yes |
|
|
|
|
#### ConversationVariableUpdatePayloadWithUser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | No |
|
|
| value | | The new value for the variable. Must match the variable's expected type. | Yes |
|
|
|
|
#### ConversationVariablesQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| last_id | string | The ID of the last record on the current page. Used to fetch the next page. | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of records to return. | No |
|
|
| variable_name | string | Filter variables by a specific name. | No |
|
|
|
|
#### CustomConfigurationStatus
|
|
|
|
Enum class for custom configuration status.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| CustomConfigurationStatus | string | Enum class for custom configuration status. | |
|
|
|
|
#### DatasetBoundTagListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DatasetBoundTagResponse](#datasetboundtagresponse) ] | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### DatasetBoundTagResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### DatasetCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | Description of the knowledge base. | No |
|
|
| embedding_model | string | Embedding model name. Use the `model` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No |
|
|
| embedding_model_provider | string | Embedding model provider. Use the `provider` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No |
|
|
| external_knowledge_api_id | string | ID of the external knowledge API. | No |
|
|
| external_knowledge_id | string | ID of the external knowledge base. | No |
|
|
| indexing_technique | string, <br>**Available values:** "economy", "high_quality" | `high_quality` uses embedding models for precise search; `economy` uses keyword-based indexing. | No |
|
|
| name | string | Name of the knowledge base. | Yes |
|
|
| permission | [PermissionEnum](#permissionenum) | Controls who can access this knowledge base. `only_me` restricts access to the creator, `all_team_members` grants workspace-wide access, and `partial_members` grants access to specified members. | No |
|
|
| provider | string, <br>**Available values:** "external", "vendor", <br>**Default:** vendor | Knowledge base provider: `vendor` for internal knowledge bases, `external` for external ones.<br>*Enum:* `"external"`, `"vendor"` | No |
|
|
| retrieval_model | [RetrievalModel](#retrievalmodel) | Retrieval model configuration. Controls how chunks are searched and ranked when querying this knowledge base. | No |
|
|
| summary_index_setting | object | Summary index configuration. | No |
|
|
|
|
#### DatasetDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_count | integer | | Yes |
|
|
| author_name | string | | Yes |
|
|
| built_in_field_enabled | boolean | | Yes |
|
|
| chunk_structure | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| data_source_type | string | | Yes |
|
|
| description | string | | Yes |
|
|
| doc_form | string | | Yes |
|
|
| doc_metadata | [ [DatasetDocMetadataResponse](#datasetdocmetadataresponse) ] | | Yes |
|
|
| document_count | integer | | Yes |
|
|
| embedding_available | boolean | | No |
|
|
| embedding_model | string | | Yes |
|
|
| embedding_model_provider | string | | Yes |
|
|
| enable_api | boolean | | Yes |
|
|
| external_knowledge_info | [DatasetExternalKnowledgeInfoResponse](#datasetexternalknowledgeinforesponse) | Connection details for external knowledge bases. Populated when `provider` is `external`; otherwise its properties are `null`. | No |
|
|
| external_retrieval_model | [DatasetExternalRetrievalModelResponse](#datasetexternalretrievalmodelresponse) | | Yes |
|
|
| icon_info | [DatasetIconInfoResponse](#dataseticoninforesponse) | Icon display configuration for the knowledge base. | No |
|
|
| id | string | | Yes |
|
|
| indexing_technique | string | | Yes |
|
|
| is_multimodal | boolean | | Yes |
|
|
| is_published | boolean | | Yes |
|
|
| maintainer | string | | No |
|
|
| name | string | | Yes |
|
|
| permission | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| pipeline_id | string | | Yes |
|
|
| provider | string | | Yes |
|
|
| retrieval_model_dict | [DatasetRetrievalModelResponse](#datasetretrievalmodelresponse) | Retrieval configuration for the knowledge base. | Yes |
|
|
| runtime_mode | string | | Yes |
|
|
| summary_index_setting | [DatasetSummaryIndexSettingResponse](#datasetsummaryindexsettingresponse) | Summary index configuration. | No |
|
|
| tags | [ [DatasetTagResponse](#datasettagresponse) ] | | Yes |
|
|
| total_available_documents | integer | | Yes |
|
|
| total_documents | integer | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| updated_by | string | | Yes |
|
|
| word_count | integer | | Yes |
|
|
|
|
#### DatasetDetailWithPartialMembersResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_count | integer | | Yes |
|
|
| author_name | string | | Yes |
|
|
| built_in_field_enabled | boolean | | Yes |
|
|
| chunk_structure | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| data_source_type | string | | Yes |
|
|
| description | string | | Yes |
|
|
| doc_form | string | | Yes |
|
|
| doc_metadata | [ [DatasetDocMetadataResponse](#datasetdocmetadataresponse) ] | | Yes |
|
|
| document_count | integer | | Yes |
|
|
| embedding_available | boolean | | No |
|
|
| embedding_model | string | | Yes |
|
|
| embedding_model_provider | string | | Yes |
|
|
| enable_api | boolean | | Yes |
|
|
| external_knowledge_info | [DatasetExternalKnowledgeInfoResponse](#datasetexternalknowledgeinforesponse) | Connection details for external knowledge bases. Populated when `provider` is `external`; otherwise its properties are `null`. | No |
|
|
| external_retrieval_model | [DatasetExternalRetrievalModelResponse](#datasetexternalretrievalmodelresponse) | | Yes |
|
|
| icon_info | [DatasetIconInfoResponse](#dataseticoninforesponse) | Icon display configuration for the knowledge base. | No |
|
|
| id | string | | Yes |
|
|
| indexing_technique | string | | Yes |
|
|
| is_multimodal | boolean | | Yes |
|
|
| is_published | boolean | | Yes |
|
|
| maintainer | string | | No |
|
|
| name | string | | Yes |
|
|
| partial_member_list | [ string ] | | No |
|
|
| permission | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| pipeline_id | string | | Yes |
|
|
| provider | string | | Yes |
|
|
| retrieval_model_dict | [DatasetRetrievalModelResponse](#datasetretrievalmodelresponse) | Retrieval configuration for the knowledge base. | Yes |
|
|
| runtime_mode | string | | Yes |
|
|
| summary_index_setting | [DatasetSummaryIndexSettingResponse](#datasetsummaryindexsettingresponse) | Summary index configuration. | No |
|
|
| tags | [ [DatasetTagResponse](#datasettagresponse) ] | | Yes |
|
|
| total_available_documents | integer | | Yes |
|
|
| total_documents | integer | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| updated_by | string | | Yes |
|
|
| word_count | integer | | Yes |
|
|
|
|
#### DatasetDocMetadataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DatasetExternalKnowledgeInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| external_knowledge_api_endpoint | string | | No |
|
|
| external_knowledge_api_id | string | | No |
|
|
| external_knowledge_api_name | string | | No |
|
|
| external_knowledge_id | string | | No |
|
|
|
|
#### DatasetExternalRetrievalModelResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| score_threshold | number | | No |
|
|
| score_threshold_enabled | boolean | | No |
|
|
| top_k | integer | | Yes |
|
|
|
|
#### DatasetIconInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| icon_url | string | | No |
|
|
|
|
#### DatasetKeywordSettingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword_weight | number | | No |
|
|
|
|
#### DatasetListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| include_all | boolean | Whether to include all knowledge bases regardless of permissions. | No |
|
|
| keyword | string | Search keyword to filter by name. | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of items per page. Server caps at `100`. | No |
|
|
| page | integer, <br>**Default:** 1 | Page number to retrieve. | No |
|
|
| tag_ids | [ string ] | Tag IDs to filter by. | No |
|
|
|
|
#### DatasetListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DatasetDetailResponse](#datasetdetailresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### DatasetMetadataActionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | Operation result. | Yes |
|
|
|
|
#### DatasetMetadataBuiltInFieldResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DatasetMetadataBuiltInFieldsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| fields | [ [DatasetMetadataBuiltInFieldResponse](#datasetmetadatabuiltinfieldresponse) ] | | Yes |
|
|
|
|
#### DatasetMetadataListItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| count | integer | | No |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DatasetMetadataListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| built_in_field_enabled | boolean | | Yes |
|
|
| doc_metadata | [ [DatasetMetadataListItemResponse](#datasetmetadatalistitemresponse) ] | | Yes |
|
|
|
|
#### DatasetMetadataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DatasetRerankingModelResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| reranking_model_name | string | | No |
|
|
| reranking_provider_name | string | | No |
|
|
|
|
#### DatasetRetrievalModelResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| reranking_enable | boolean | | Yes |
|
|
| reranking_mode | string | | No |
|
|
| reranking_model | [DatasetRerankingModelResponse](#datasetrerankingmodelresponse) | Reranking model configuration. | No |
|
|
| score_threshold | number | | No |
|
|
| score_threshold_enabled | boolean | | Yes |
|
|
| search_method | string | | Yes |
|
|
| top_k | integer | | Yes |
|
|
| weights | [DatasetWeightedScoreResponse](#datasetweightedscoreresponse) | | No |
|
|
|
|
#### DatasetSummaryIndexSettingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enable | boolean | | No |
|
|
| model_name | string | | No |
|
|
| model_provider_name | string | | No |
|
|
| summary_prompt | string | | No |
|
|
|
|
#### DatasetTagResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DatasetUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | Description of the knowledge base. | No |
|
|
| embedding_model | string | Embedding model name. Use the `model` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No |
|
|
| embedding_model_provider | string | Embedding model provider. Use the `provider` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No |
|
|
| external_knowledge_api_id | string | ID of the external knowledge API. | No |
|
|
| external_knowledge_id | string | ID of the external knowledge base. | No |
|
|
| external_retrieval_model | object | Retrieval settings for external knowledge bases. | No |
|
|
| indexing_technique | string, <br>**Available values:** "economy", "high_quality" | `high_quality` uses embedding models for precise search; `economy` uses keyword-based indexing. | No |
|
|
| name | string | Name of the knowledge base. | No |
|
|
| partial_member_list | [ object ] | List of team members with access when `permission` is `partial_members`. | No |
|
|
| permission | [PermissionEnum](#permissionenum) | Controls who can access this knowledge base. `only_me` restricts access to the creator, `all_team_members` grants workspace-wide access, and `partial_members` grants access to specified members. | No |
|
|
| retrieval_model | [RetrievalModel](#retrievalmodel) | Retrieval model configuration. Controls how chunks are searched and ranked when querying this knowledge base. | No |
|
|
|
|
#### DatasetVectorSettingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding_model_name | string | | No |
|
|
| embedding_provider_name | string | | No |
|
|
| vector_weight | number | | No |
|
|
|
|
#### DatasetWeightedScoreResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword_setting | [DatasetKeywordSettingResponse](#datasetkeywordsettingresponse) | Keyword search weight settings. | No |
|
|
| vector_setting | [DatasetVectorSettingResponse](#datasetvectorsettingresponse) | Semantic search weight settings. | No |
|
|
| weight_type | string | | No |
|
|
|
|
#### DatasourceCredentialInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | No |
|
|
| is_default | boolean | | No |
|
|
| name | string | | No |
|
|
| type | string | | No |
|
|
|
|
#### DatasourceNodeRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | Datasource credential ID. Uses the default if omitted. | No |
|
|
| datasource_type | string, <br>**Available values:** "local_file", "online_document", "online_drive", "website_crawl" | Type of the datasource.<br>*Enum:* `"local_file"`, `"online_document"`, `"online_drive"`, `"website_crawl"` | Yes |
|
|
| inputs | object | Input variables for the datasource node. | Yes |
|
|
| is_published | boolean | Whether to run the published or draft version of the node. `true` runs the published version, `false` runs the draft. | Yes |
|
|
|
|
#### DatasourcePluginListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| DatasourcePluginListResponse | array | | |
|
|
|
|
#### DatasourcePluginResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | [ [DatasourceCredentialInfoResponse](#datasourcecredentialinforesponse) ] | | No |
|
|
| datasource_type | string | | No |
|
|
| node_id | string | | No |
|
|
| plugin_id | string | | No |
|
|
| provider_name | string | | No |
|
|
| title | string | | No |
|
|
| user_input_variables | [ object ] | | No |
|
|
|
|
#### DatasourcePluginsQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| is_published | boolean, <br>**Default:** true | Whether to retrieve nodes from the published or draft pipeline. `true` returns nodes from the published version, `false` returns nodes from the draft. | No |
|
|
|
|
#### DocumentAndBatchResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| batch | string | | Yes |
|
|
| document | [DocumentResponse](#documentresponse) | | Yes |
|
|
|
|
#### DocumentBatchDownloadZipPayload
|
|
|
|
Request payload for bulk downloading documents as a zip archive.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_ids | [ string (uuid) ] | List of document IDs to include in the ZIP download. | Yes |
|
|
|
|
#### DocumentDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| archived | boolean | | No |
|
|
| average_segment_length | integer<br>number | | No |
|
|
| completed_at | integer | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| created_from | string | | No |
|
|
| data_source_info | object | | No |
|
|
| data_source_type | string | | No |
|
|
| dataset_process_rule | object | | No |
|
|
| dataset_process_rule_id | string | | No |
|
|
| disabled_at | integer | | No |
|
|
| disabled_by | string | | No |
|
|
| display_status | string | | No |
|
|
| doc_form | string | | No |
|
|
| doc_language | string | | No |
|
|
| doc_metadata | [ [DocumentMetadataResponse](#documentmetadataresponse) ]<br>object | | No |
|
|
| doc_type | string | | No |
|
|
| document_process_rule | object | | No |
|
|
| enabled | boolean | | No |
|
|
| error | string | | No |
|
|
| hit_count | integer | | No |
|
|
| id | string | | Yes |
|
|
| indexing_latency | number | | No |
|
|
| indexing_status | string | | No |
|
|
| name | string | | No |
|
|
| need_summary | boolean | | No |
|
|
| position | integer | | No |
|
|
| segment_count | integer | | No |
|
|
| summary_index_status | string | | No |
|
|
| tokens | integer | | No |
|
|
| updated_at | integer | | No |
|
|
|
|
#### DocumentGetQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| metadata | string, <br>**Available values:** "all", "only", "without", <br>**Default:** all | `all` returns all fields including metadata. `only` returns only `id`, `doc_type`, and `doc_metadata`. `without` returns all fields except `doc_metadata`.<br>*Enum:* `"all"`, `"only"`, `"without"` | No |
|
|
|
|
#### DocumentListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword | string | Search keyword to filter by document name. | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of items per page. Server caps at `100`. | No |
|
|
| page | integer, <br>**Default:** 1 | Page number to retrieve. | No |
|
|
| status | string, <br>**Available values:** "archived", "available", "disabled", "error", "indexing", "paused", "queuing" | Filter by display status. | No |
|
|
|
|
#### DocumentListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DocumentResponse](#documentresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### DocumentMetadataOperation
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_id | string (uuid) | Document ID whose metadata should be updated. | Yes |
|
|
| metadata_list | [ [MetadataDetail](#metadatadetail) ] | Metadata fields to update. | Yes |
|
|
| partial_update | boolean | Whether to partially update metadata, keeping existing values for unspecified fields. | No |
|
|
|
|
#### DocumentMetadataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
| value | string<br>integer<br>number<br>boolean | | No |
|
|
|
|
#### DocumentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| archived | boolean | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| created_from | string | | No |
|
|
| data_source_detail_dict | object | | Yes |
|
|
| data_source_info | object | | No |
|
|
| data_source_type | string | | No |
|
|
| dataset_process_rule_id | string | | No |
|
|
| disabled_at | integer | | No |
|
|
| disabled_by | string | | No |
|
|
| display_status | string | | No |
|
|
| doc_form | string | | No |
|
|
| doc_metadata | [ [DocumentMetadataResponse](#documentmetadataresponse) ] | | No |
|
|
| enabled | boolean | | No |
|
|
| error | string | | No |
|
|
| hit_count | integer | | No |
|
|
| id | string | | Yes |
|
|
| indexing_status | string | | No |
|
|
| name | string | | Yes |
|
|
| need_summary | boolean | | No |
|
|
| position | integer | | No |
|
|
| summary_index_status | string | | No |
|
|
| tokens | integer | | No |
|
|
| word_count | integer | | No |
|
|
|
|
#### DocumentStatusListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DocumentStatusResponse](#documentstatusresponse) ] | | Yes |
|
|
|
|
#### DocumentStatusPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_ids | [ string ] | List of document IDs to update. | No |
|
|
|
|
#### DocumentStatusResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cleaning_completed_at | integer | | Yes |
|
|
| completed_at | integer | | Yes |
|
|
| completed_segments | integer | | No |
|
|
| error | string | | Yes |
|
|
| error_code | string | | No |
|
|
| estimated_vector_space_mb | integer | | No |
|
|
| id | string | | Yes |
|
|
| indexing_status | string | | Yes |
|
|
| parsing_completed_at | integer | | Yes |
|
|
| paused_at | integer | | Yes |
|
|
| processing_started_at | integer | | Yes |
|
|
| splitting_completed_at | integer | | Yes |
|
|
| stopped_at | integer | | Yes |
|
|
| total_segments | integer | | No |
|
|
| vector_space_limit_mb | integer | | No |
|
|
|
|
#### DocumentTextCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| doc_form | string, <br>**Available values:** "hierarchical_model", "qa_model", "text_model", <br>**Default:** text_model | `text_model` for standard text chunking, `hierarchical_model` for parent-child chunk structure, `qa_model` for question-answer pair extraction.<br>*Enum:* `"hierarchical_model"`, `"qa_model"`, `"text_model"` | No |
|
|
| doc_language | string, <br>**Default:** English | Language of the document for processing optimization. | No |
|
|
| embedding_model | string | Embedding model name. Use the `model` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No |
|
|
| embedding_model_provider | string | Embedding model provider. Use the `provider` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No |
|
|
| indexing_technique | string, <br>**Available values:** "economy", "high_quality" | `high_quality` uses embedding models for precise search; `economy` uses keyword-based indexing. Required when adding the first document to a knowledge base; subsequent documents inherit the knowledge base's indexing technique if omitted. | No |
|
|
| name | string | Document name. | Yes |
|
|
| original_document_id | string | Original document ID for replacement. | No |
|
|
| process_rule | [ProcessRule](#processrule) | Processing rules for chunking. | No |
|
|
| retrieval_model | [RetrievalModel](#retrievalmodel) | Controls how chunks are searched and ranked when querying this knowledge base. | No |
|
|
| text | string | Document text content. | Yes |
|
|
|
|
#### DocumentTextUpdate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| doc_form | string, <br>**Available values:** "hierarchical_model", "qa_model", "text_model", <br>**Default:** text_model | `text_model` for standard text chunking, `hierarchical_model` for parent-child chunk structure, `qa_model` for question-answer pair extraction.<br>*Enum:* `"hierarchical_model"`, `"qa_model"`, `"text_model"` | No |
|
|
| doc_language | string, <br>**Default:** English | Language of the document for processing optimization. | No |
|
|
| name | string | Document name. Required when `text` is provided. | No |
|
|
| process_rule | [ProcessRule](#processrule) | Processing rules for chunking. | No |
|
|
| retrieval_model | [RetrievalModel](#retrievalmodel) | Controls how chunks are searched and ranked when querying this knowledge base. | No |
|
|
| text | string | Document text content. | No |
|
|
|
|
#### EndUserDetail
|
|
|
|
Full EndUser record for API responses.
|
|
|
|
Note: The SQLAlchemy model defines an `is_anonymous` property for Flask-Login semantics
|
|
(always False). The database column is exposed as `_is_anonymous`, so this DTO maps
|
|
`is_anonymous` from `_is_anonymous` to return the stored value.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | No |
|
|
| created_at | dateTime | | Yes |
|
|
| external_user_id | string | | No |
|
|
| id | string (uuid) | | Yes |
|
|
| is_anonymous | boolean | | Yes |
|
|
| name | string | | No |
|
|
| session_id | string | | Yes |
|
|
| tenant_id | string (uuid) | | Yes |
|
|
| type | string | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
|
|
#### EventStreamResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| EventStreamResponse | string | | |
|
|
|
|
#### ExecutionContentType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ExecutionContentType | string | | |
|
|
|
|
#### FeedbackListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| limit | integer, <br>**Default:** 20 | Number of records per page. | No |
|
|
| page | integer, <br>**Default:** 1 | Page number for pagination. | No |
|
|
|
|
#### FetchFrom
|
|
|
|
Enum class for fetch from.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| FetchFrom | string | Enum class for fetch from. | |
|
|
|
|
#### FileInputConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_file_extensions | [ string ] | | No |
|
|
| allowed_file_types | [ [FileType](#filetype) ] | | No |
|
|
| allowed_file_upload_methods | [ [FileTransferMethod](#filetransfermethod) ] | | No |
|
|
| output_variable_name | string | | Yes |
|
|
| type | string | | No |
|
|
|
|
#### FileListInputConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_file_extensions | [ string ] | | No |
|
|
| allowed_file_types | [ [FileType](#filetype) ] | | No |
|
|
| allowed_file_upload_methods | [ [FileTransferMethod](#filetransfermethod) ] | | No |
|
|
| number_limits | integer | | No |
|
|
| output_variable_name | string | | Yes |
|
|
| type | string | | No |
|
|
|
|
#### FilePreviewQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| as_attachment | boolean | If `true`, forces the file to download as an attachment instead of previewing in browser. | No |
|
|
|
|
#### FileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| extension | string | | No |
|
|
| file_key | string | | No |
|
|
| id | string (uuid) | | Yes |
|
|
| mime_type | string | | No |
|
|
| name | string | | Yes |
|
|
| original_url | string | | No |
|
|
| preview_url | string | | No |
|
|
| reference | string | | No |
|
|
| size | integer | | Yes |
|
|
| source_url | string | | No |
|
|
| tenant_id | string | | No |
|
|
| user_id | string | | No |
|
|
|
|
#### FileTransferMethod
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| FileTransferMethod | string | | |
|
|
|
|
#### FileType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| FileType | string | | |
|
|
|
|
#### FormInputConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| FormInputConfig | [ParagraphInputConfig](#paragraphinputconfig)<br>[SelectInputConfig](#selectinputconfig)<br>[FileInputConfig](#fileinputconfig)<br>[FileListInputConfig](#filelistinputconfig) | | |
|
|
|
|
#### HitTestingChildChunk
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
| id | string | | Yes |
|
|
| position | integer | | Yes |
|
|
| score | number | | Yes |
|
|
|
|
#### HitTestingDocument
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data_source_type | string | | Yes |
|
|
| doc_metadata | | | Yes |
|
|
| doc_type | string | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### HitTestingFile
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| extension | string | | Yes |
|
|
| id | string | | Yes |
|
|
| mime_type | string | | Yes |
|
|
| name | string | | Yes |
|
|
| size | integer | | Yes |
|
|
| source_url | string | | Yes |
|
|
|
|
#### HitTestingPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| attachment_ids | [ string ] | List of attachment IDs to include in the retrieval context. | No |
|
|
| external_retrieval_model | object | Retrieval settings for external knowledge bases. | No |
|
|
| query | string | Search query text. | Yes |
|
|
| retrieval_model | [RetrievalModel](#retrievalmodel) | Retrieval model configuration. Controls how chunks are searched and ranked when querying this knowledge base. | No |
|
|
|
|
#### HitTestingQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
|
|
#### HitTestingRecord
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| child_chunks | [ [HitTestingChildChunk](#hittestingchildchunk) ] | | Yes |
|
|
| files | [ [HitTestingFile](#hittestingfile) ] | | Yes |
|
|
| score | number | | Yes |
|
|
| segment | [HitTestingSegment](#hittestingsegment) | Matched chunk from the knowledge base. | Yes |
|
|
| summary | string | | Yes |
|
|
| tsne_position | | | Yes |
|
|
|
|
#### HitTestingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| query | [HitTestingQuery](#hittestingquery) | The original query object. | Yes |
|
|
| records | [ [HitTestingRecord](#hittestingrecord) ] | | Yes |
|
|
|
|
#### HitTestingSegment
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| completed_at | integer | | Yes |
|
|
| content | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| disabled_at | integer | | Yes |
|
|
| disabled_by | string | | Yes |
|
|
| document | [HitTestingDocument](#hittestingdocument) | Parent document information for the matched chunk. | Yes |
|
|
| document_id | string | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
| error | string | | Yes |
|
|
| hit_count | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| index_node_hash | string | | Yes |
|
|
| index_node_id | string | | Yes |
|
|
| indexing_at | integer | | Yes |
|
|
| keywords | [ string ] | | Yes |
|
|
| position | integer | | Yes |
|
|
| sign_content | string | | Yes |
|
|
| status | string | | Yes |
|
|
| stopped_at | integer | | Yes |
|
|
| tokens | integer | | Yes |
|
|
| word_count | integer | | Yes |
|
|
|
|
#### HumanInputContent
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| form_definition | [HumanInputFormDefinition](#humaninputformdefinition) | | No |
|
|
| form_submission_data | [HumanInputFormSubmissionData](#humaninputformsubmissiondata) | | No |
|
|
| submitted | boolean | | Yes |
|
|
| type | [ExecutionContentType](#executioncontenttype) | | No |
|
|
| workflow_run_id | string | | Yes |
|
|
|
|
#### HumanInputFormDefinition
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| actions | [ [UserActionConfig](#useractionconfig) ] | | No |
|
|
| display_in_ui | boolean | | No |
|
|
| expiration_time | integer | | Yes |
|
|
| form_content | string | | Yes |
|
|
| form_id | string | | Yes |
|
|
| form_token | string | | No |
|
|
| inputs | [ [FormInputConfig](#forminputconfig) ] | | No |
|
|
| node_id | string | | Yes |
|
|
| node_title | string | | Yes |
|
|
| resolved_default_values | object | | No |
|
|
|
|
#### HumanInputFormDefinitionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expiration_time | integer | | No |
|
|
| form_content | string | | Yes |
|
|
| inputs | [ [FormInputConfig](#forminputconfig) ] | | Yes |
|
|
| resolved_default_values | object | | Yes |
|
|
| user_actions | [ [UserActionConfig](#useractionconfig) ] | | Yes |
|
|
|
|
#### HumanInputFormSubmissionData
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| action_id | string | | Yes |
|
|
| action_text | string | | Yes |
|
|
| node_id | string | | Yes |
|
|
| node_title | string | | Yes |
|
|
| rendered_content | string | | Yes |
|
|
| submitted_data | object | | No |
|
|
|
|
#### HumanInputFormSubmitPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| action | string | ID of the action button the recipient selected. Must match one of the `id` values from the form's `user_actions` list. | Yes |
|
|
| inputs | object | Submitted human input values keyed by output variable name. Use a string for paragraph or select input values, a file mapping for file inputs, and a list of file mappings for file-list inputs. Local file mappings use `transfer_method=local_file` with `upload_file_id`; remote file mappings use `transfer_method=remote_url` with `url` or `remote_url`. | Yes |
|
|
|
|
#### HumanInputFormSubmitPayloadWithUser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| action | string | ID of the action button the recipient selected. Must match one of the `id` values from the form's `user_actions` list. | Yes |
|
|
| inputs | object | Submitted human input values keyed by output variable name. Use a string for paragraph or select input values, a file mapping for file inputs, and a list of file mappings for file-list inputs. Local file mappings use `transfer_method=local_file` with `upload_file_id`; remote file mappings use `transfer_method=remote_url` with `url` or `remote_url`. | Yes |
|
|
| user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | Yes |
|
|
|
|
#### HumanInputFormSubmitResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
|
|
#### I18nObject
|
|
|
|
Model class for i18n object.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| en_US | string | | Yes |
|
|
| zh_Hans | string | | No |
|
|
|
|
#### IndexInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| api_version | string | | Yes |
|
|
| server_version | string | | Yes |
|
|
| welcome | string | | Yes |
|
|
|
|
#### JSONObject
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| JSONObject | object | | |
|
|
|
|
#### JSONValue
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| JSONValue | | | |
|
|
|
|
#### JSONValueType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| JSONValueType | | | |
|
|
|
|
#### JsonValue
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| JsonValue | | | |
|
|
|
|
#### KnowledgeFSActiveProfileRevisions
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding | integer | | No |
|
|
| retrieval | integer | | No |
|
|
|
|
#### KnowledgeFSAdmittedQueryRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| activeDocumentIds | [ string ] | | No |
|
|
| activeEntityIds | [ string ] | | No |
|
|
| knowledgeSpaceId | string | | Yes |
|
|
| mode | string, <br>**Available values:** "auto", "deep", "fast", "research" | | No |
|
|
| query | string | | No |
|
|
| queryImages | [ [KnowledgeFSQueryImageReference](#knowledgefsqueryimagereference) ] | | No |
|
|
| sessionId | string | | No |
|
|
|
|
#### KnowledgeFSAnswerTraceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | dateTime | | Yes |
|
|
| evidence_bundle_id | string | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| mode | string, <br>**Available values:** "auto", "deep", "fast", "research" | *Enum:* `"auto"`, `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| query | string | | Yes |
|
|
| query_images | [ [KnowledgeFSQueryImageResponse](#knowledgefsqueryimageresponse) ] | | No |
|
|
| steps | [ [KnowledgeFSAnswerTraceStepResponse](#knowledgefsanswertracestepresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSAnswerTraceStepResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ended_at | string | | No |
|
|
| metadata | object | | Yes |
|
|
| name | string | | Yes |
|
|
| started_at | dateTime | | Yes |
|
|
| status | string, <br>**Available values:** "error", "ok", "skipped" | *Enum:* `"error"`, `"ok"`, `"skipped"` | Yes |
|
|
|
|
#### KnowledgeFSBulkDeletionAcceptedItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_id | string | | Yes |
|
|
| document_title | string | | No |
|
|
| job | [KnowledgeFSDurableDeletionJobResponse](#knowledgefsdurabledeletionjobresponse) | | Yes |
|
|
| status_url | string | | Yes |
|
|
|
|
#### KnowledgeFSBulkDeletionAcceptedResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [KnowledgeFSBulkDeletionAcceptedItemResponse](#knowledgefsbulkdeletionaccepteditemresponse) ] | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### KnowledgeFSBulkDocumentDeleteItemPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| documentId | string | | Yes |
|
|
| expectedRevision | integer | | Yes |
|
|
|
|
#### KnowledgeFSBulkDocumentDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| documents | [ [KnowledgeFSBulkDocumentDeleteItemPayload](#knowledgefsbulkdocumentdeleteitempayload) ] | | Yes |
|
|
|
|
#### KnowledgeFSBulkJobResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| canceled_items | integer | | Yes |
|
|
| completed_items | integer | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| failed_item_ids | [ string ] | | Yes |
|
|
| failed_items | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| status | string, <br>**Available values:** "canceled", "completed", "failed", "running" | *Enum:* `"canceled"`, `"completed"`, `"failed"`, `"running"` | Yes |
|
|
| total_items | integer | | Yes |
|
|
| type | string, <br>**Available values:** "document_delete", "document_reindex", "document_upload" | *Enum:* `"document_delete"`, `"document_reindex"`, `"document_upload"` | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
|
|
#### KnowledgeFSCrawledPageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
| description | string | | No |
|
|
| source_url | string | | Yes |
|
|
| title | string | | No |
|
|
|
|
#### KnowledgeFSCursorQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
|
|
#### KnowledgeFSDocumentChunkListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
| query | string | | No |
|
|
|
|
#### KnowledgeFSDocumentChunkListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSDocumentChunkResponse](#knowledgefsdocumentchunkresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSDocumentChunkResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | dateTime | | Yes |
|
|
| document_id | string | | Yes |
|
|
| document_revision | integer | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
| end_offset | integer | | No |
|
|
| id | string | | Yes |
|
|
| kind | string, <br>**Available values:** "chunk", "image", "section", "summary", "table", <br>**Default:** chunk | *Enum:* `"chunk"`, `"image"`, `"section"`, `"summary"`, `"table"` | No |
|
|
| knowledge_space_id | string | | Yes |
|
|
| ordinal | integer | | Yes |
|
|
| parent_chunk_id | string | | No |
|
|
| parse_element_ids | [ string ] | | Yes |
|
|
| section_path | [ string ] | | No |
|
|
| start_offset | integer | | No |
|
|
| text | string | | Yes |
|
|
| token_count | integer | | Yes |
|
|
| user_metadata | object | | Yes |
|
|
|
|
#### KnowledgeFSDocumentCompilationJobResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| base_head_revision | integer | | No |
|
|
| candidate_fingerprint | string | | No |
|
|
| candidate_publication_id | string | | No |
|
|
| completed_at | number | | No |
|
|
| created_at | number | | Yes |
|
|
| document_asset_id | string | | Yes |
|
|
| error | string | | No |
|
|
| execution_attempts | integer | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| max_execution_attempts | integer | | No |
|
|
| run_state | string | | No |
|
|
| stage | string, <br>**Available values:** "canceled", "failed", "nodes_generated", "outline_built", "parsed", "projection_built", "published", "queued", "smoke_eval_passed" | *Enum:* `"canceled"`, `"failed"`, `"nodes_generated"`, `"outline_built"`, `"parsed"`, `"projection_built"`, `"published"`, `"queued"`, `"smoke_eval_passed"` | Yes |
|
|
| updated_at | number | | Yes |
|
|
| version | integer | | Yes |
|
|
|
|
#### KnowledgeFSDocumentDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expectedRevision | integer | | Yes |
|
|
|
|
#### KnowledgeFSDocumentListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSDocumentResponse](#knowledgefsdocumentresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSDocumentMetadataPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expectedRowVersion | integer | | Yes |
|
|
| patch | object | | Yes |
|
|
|
|
#### KnowledgeFSDocumentOutlineNodeResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| child_node_ids | [ string ] | | No |
|
|
| children | [ [KnowledgeFSDocumentOutlineNodeResponse](#knowledgefsdocumentoutlinenoderesponse) ] | | No |
|
|
| end_offset | integer | | No |
|
|
| end_page | integer | | No |
|
|
| id | string | | Yes |
|
|
| level | integer | | Yes |
|
|
| metadata | object | | Yes |
|
|
| section_path | [ string ] | | No |
|
|
| source_element_ids | [ string ] | | No |
|
|
| source_node_ids | [ string ] | | No |
|
|
| start_offset | integer | | No |
|
|
| start_page | integer | | No |
|
|
| summary | string | | No |
|
|
| title | string | | Yes |
|
|
| title_location | object | | No |
|
|
| toc_source | string | | Yes |
|
|
|
|
#### KnowledgeFSDocumentOutlineResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| artifact_hash | string | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| document_asset_id | string | | Yes |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| metadata | object | | Yes |
|
|
| nodes | [ [KnowledgeFSDocumentOutlineNodeResponse](#knowledgefsdocumentoutlinenoderesponse) ] | | Yes |
|
|
| outline_version | string | | Yes |
|
|
| parse_artifact_id | string | | Yes |
|
|
| updated_at | string | | No |
|
|
| version | integer | | Yes |
|
|
|
|
#### KnowledgeFSDocumentReindexItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| asset | [KnowledgeFSDocumentResponse](#knowledgefsdocumentresponse) | | No |
|
|
| compilation_job | object | | No |
|
|
| document_id | string | | No |
|
|
| status | string, <br>**Available values:** "disabled", "not_found", "queued" | *Enum:* `"disabled"`, `"not_found"`, `"queued"` | Yes |
|
|
| status_url | string | | No |
|
|
|
|
#### KnowledgeFSDocumentReindexPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| all | boolean | | No |
|
|
| documentIds | [ string ] | | No |
|
|
|
|
#### KnowledgeFSDocumentReindexResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| bulk_job_id | string | | Yes |
|
|
| items | [ [KnowledgeFSDocumentReindexItemResponse](#knowledgefsdocumentreindexitemresponse) ] | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### KnowledgeFSDocumentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | dateTime | | Yes |
|
|
| filename | string | | Yes |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| metadata | object | | Yes |
|
|
| mime_type | string | | Yes |
|
|
| object_key | string | | Yes |
|
|
| parser_status | string, <br>**Available values:** "failed", "parsed", "pending" | *Enum:* `"failed"`, `"parsed"`, `"pending"` | Yes |
|
|
| sha256 | string | | Yes |
|
|
| size_bytes | integer | | Yes |
|
|
| source_id | string | | No |
|
|
| updated_at | string | | No |
|
|
| version | integer | | Yes |
|
|
|
|
#### KnowledgeFSDocumentRevisionListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSDocumentRevisionResponse](#knowledgefsdocumentrevisionresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSDocumentRevisionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| activated_at | string | | No |
|
|
| content_hash | string | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| document_asset_id | string | | Yes |
|
|
| document_asset_version | integer | | Yes |
|
|
| document_id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| mime_type | string | | Yes |
|
|
| revision | integer | | Yes |
|
|
| size_bytes | integer | | Yes |
|
|
| state | string, <br>**Available values:** "active", "candidate", "failed", "superseded" | *Enum:* `"active"`, `"candidate"`, `"failed"`, `"superseded"` | Yes |
|
|
|
|
#### KnowledgeFSDurableDeletionAcceptedResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_title | string | | No |
|
|
| job | [KnowledgeFSDurableDeletionJobResponse](#knowledgefsdurabledeletionjobresponse) | | Yes |
|
|
| status_url | string | | Yes |
|
|
|
|
#### KnowledgeFSDurableDeletionErrorResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| message | string | | Yes |
|
|
| retryable | boolean | | Yes |
|
|
|
|
#### KnowledgeFSDurableDeletionJobResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| checkpoint | string, <br>**Available values:** "completed", "deleting_derived_data", "deleting_objects", "deleting_primary_data", "quiescing", "requested" | *Enum:* `"completed"`, `"deleting_derived_data"`, `"deleting_objects"`, `"deleting_primary_data"`, `"quiescing"`, `"requested"` | Yes |
|
|
| completed_at | string | | No |
|
|
| created_at | dateTime | | Yes |
|
|
| error | [KnowledgeFSDurableDeletionErrorResponse](#knowledgefsdurabledeletionerrorresponse) | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| mode | string, <br>**Available values:** "cascade", "keep" | | No |
|
|
| progress | [KnowledgeFSDurableDeletionProgressResponse](#knowledgefsdurabledeletionprogressresponse) | | No |
|
|
| retry_at | string | | No |
|
|
| run_state | string, <br>**Available values:** "canceled", "completed", "dispatch_pending", "failed", "queued", "retry_wait", "running" | *Enum:* `"canceled"`, `"completed"`, `"dispatch_pending"`, `"failed"`, `"queued"`, `"retry_wait"`, `"running"` | Yes |
|
|
| target_id | string | | Yes |
|
|
| target_type | string, <br>**Available values:** "document", "knowledge_space", "logical_document", "source" | *Enum:* `"document"`, `"knowledge_space"`, `"logical_document"`, `"source"` | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
|
|
#### KnowledgeFSDurableDeletionProgressResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completed_items | integer | | Yes |
|
|
| current_item_kind | string | | No |
|
|
| total_items | integer | | No |
|
|
|
|
#### KnowledgeFSEmbeddingSettingsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| dimension | integer | | No |
|
|
| model | string | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| provider | string | | Yes |
|
|
| revision | integer | | No |
|
|
| vector_space_id | string | | No |
|
|
|
|
#### KnowledgeFSLogicalDocumentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| active | [KnowledgeFSDocumentRevisionResponse](#knowledgefsdocumentrevisionresponse) | | Yes |
|
|
| active_revision | integer | | No |
|
|
| created_at | dateTime | | Yes |
|
|
| disabled_at | string | | No |
|
|
| disabled_by_subject_id | string | | No |
|
|
| enabled | boolean, <br>**Default:** true | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| provider_item_id | string | | No |
|
|
| row_version | integer | | Yes |
|
|
| source_id | string | | No |
|
|
| status | string, <br>**Available values:** "deleting", "failed", "pending", "ready" | *Enum:* `"deleting"`, `"failed"`, `"pending"`, `"ready"` | Yes |
|
|
| title | string | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
| user_metadata | object | | Yes |
|
|
|
|
#### KnowledgeFSOnlineDocumentWorkflowImportItemPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| etag | string | | No |
|
|
| lastEditedTime | string | | No |
|
|
| name | string | | No |
|
|
| pageId | string | | Yes |
|
|
| providerItemId | string | | Yes |
|
|
| type | string | | Yes |
|
|
| workspaceId | string | | Yes |
|
|
|
|
#### KnowledgeFSOnlineDriveWorkflowImportItemPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| bucket | string | | No |
|
|
| etag | string | | No |
|
|
| id | string | | Yes |
|
|
| mimeType | string | | No |
|
|
| name | string | | Yes |
|
|
| providerItemId | string | | Yes |
|
|
|
|
#### KnowledgeFSProductRerankProfile
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | Yes |
|
|
| model | [KnowledgeFSProfileModelSelection](#knowledgefsprofilemodelselection) | | No |
|
|
|
|
#### KnowledgeFSProductRetrievalProfile
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| defaultMode | string, <br>**Available values:** "deep", "fast", "research" | *Enum:* `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| reasoningModel | [KnowledgeFSProfileModelSelection](#knowledgefsprofilemodelselection) | | Yes |
|
|
| rerank | [KnowledgeFSProductRerankProfile](#knowledgefsproductrerankprofile) | | Yes |
|
|
| scoreThreshold | [KnowledgeFSProductScoreThreshold](#knowledgefsproductscorethreshold) | | Yes |
|
|
| topK | integer | | Yes |
|
|
|
|
#### KnowledgeFSProductScoreThreshold
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | Yes |
|
|
| stage | string, <br>**Available values:** "mode-final", "rerank", <br>**Default:** mode-final | *Enum:* `"mode-final"`, `"rerank"` | No |
|
|
| value | number | | No |
|
|
|
|
#### KnowledgeFSProfileModelSelection
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model | string | | Yes |
|
|
| pluginId | string | | Yes |
|
|
| provider | string | | Yes |
|
|
|
|
#### KnowledgeFSPublicFailureResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| action | string, <br>**Available values:** "configure_model", "configure_parser", "configure_source", "contact_admin", "retry", "reupload" | | No |
|
|
| category | string, <br>**Available values:** "authorization", "canceled", "configuration", "conflict", "dependency", "internal", "not_found", "rate_limit", "timeout", "validation" | *Enum:* `"authorization"`, `"canceled"`, `"configuration"`, `"conflict"`, `"dependency"`, `"internal"`, `"not_found"`, `"rate_limit"`, `"timeout"`, `"validation"` | Yes |
|
|
| code | string, <br>**Available values:** "DOCUMENT_COMPILATION_FAILED", "DOCUMENT_COMPILATION_LEASE_LOST", "DOCUMENT_COMPILATION_RETRYABLE", "DOCUMENT_DISABLED", "DOCUMENT_PARSER_INPUT_INVALID", "DOCUMENT_PARSER_NOT_CONFIGURED", "DOCUMENT_PARSER_RATE_LIMITED", "DOCUMENT_PARSER_RESPONSE_INVALID", "DOCUMENT_PARSER_TIMEOUT", "DOCUMENT_PARSER_UNAVAILABLE", "DOCUMENT_PARSER_UNSUPPORTED_TYPE", "DOCUMENT_PDF_RENDER_FAILED", "EMBEDDING_DIMENSION_INVALID", "EMBEDDING_DIMENSION_UNSUPPORTED", "EXECUTION_ATTEMPTS_EXHAUSTED", "KNOWLEDGE_FS_ACCESS_DENIED", "KNOWLEDGE_FS_CONFLICT", "KNOWLEDGE_FS_INTERNAL_ERROR", "KNOWLEDGE_FS_INVALID_REQUEST", "KNOWLEDGE_FS_NOT_FOUND", "KNOWLEDGE_FS_RATE_LIMITED", "KNOWLEDGE_FS_TIMEOUT", "KNOWLEDGE_FS_UNAVAILABLE", "KNOWLEDGE_SPACE_MANIFEST_NOT_FOUND", "KNOWLEDGE_SPACE_MODEL_CONFIGURATION_REQUIRED", "MODEL_CAPABILITY_MISMATCH", "MODEL_CONFIGURATION_STALE", "MODEL_CREDENTIAL_INVALID", "MODEL_CREDENTIAL_VALIDATION_UNAVAILABLE", "MODEL_IDENTITY_MISMATCH", "MODEL_PREFLIGHT_CANCELED", "MODEL_PREFLIGHT_FAILED", "MODEL_PREFLIGHT_TIMEOUT", "MODEL_PREFLIGHT_UNAVAILABLE", "MODEL_PROFILE_ACTIVATION_INCOMPLETE", "MODEL_PROFILE_ACTIVATION_PERMISSION_REQUIRED", "MODEL_RUNTIME_FAILED", "MODEL_RUNTIME_RESPONSE_INVALID", "MODEL_RUNTIME_TIMEOUT", "MODEL_RUNTIME_UNAVAILABLE", "MODEL_SELECTION_NOT_FOUND", "RESEARCH_TASK_CAPABILITY_REVOKED", "RESEARCH_TASK_DISPATCH_DEAD", "RESEARCH_TASK_EXECUTION_ATTEMPTS_EXHAUSTED", "RESEARCH_TASK_FAILED", "RESEARCH_TASK_PERMISSION_SNAPSHOT_INVALID", "RESEARCH_TASK_RUNTIME_SNAPSHOT_INVALID", "RETRIEVAL_DELETION_IN_PROGRESS", "RETRIEVAL_EXECUTION_LEASE_LOST", "SOURCE_BULK_ACTION_FAILED", "SOURCE_CONNECTION_UNAVAILABLE", "SOURCE_CRAWL_PAGE_NOT_FOUND", "SOURCE_CRAWL_PROVIDER_UNAVAILABLE", "SOURCE_CRAWL_RESULT_LIMIT_EXCEEDED", "SOURCE_CREDENTIAL_CONFIG_INVALID", "SOURCE_CREDENTIAL_MUTATION_FAILED", "SOURCE_CREDENTIAL_TEST_FAILED", "SOURCE_CREDENTIAL_UNAVAILABLE", "SOURCE_DOCUMENT_COMPILATION_FAILED", "SOURCE_DOCUMENT_MATERIALIZATION_FAILED", "SOURCE_DOCUMENT_REPLACEMENT_SAGA_REQUIRED", "SOURCE_IMPORT_PARTIAL_FAILURE", "SOURCE_ONLINE_DOCUMENT_CONFIG_INVALID", "SOURCE_ONLINE_DOCUMENT_IMPORT_FAILED", "SOURCE_ONLINE_DOCUMENT_PAGE_FETCH_FAILED", "SOURCE_ONLINE_DOCUMENT_REQUEST_FAILED", "SOURCE_ONLINE_DOCUMENT_UNAVAILABLE", "SOURCE_ONLINE_DRIVE_CONFIG_INVALID", "SOURCE_ONLINE_DRIVE_FILE_DOWNLOAD_FAILED", "SOURCE_ONLINE_DRIVE_IMPORT_FAILED", "SOURCE_ONLINE_DRIVE_REQUEST_FAILED", "SOURCE_ONLINE_DRIVE_UNAVAILABLE", "SOURCE_OPERATION_FAILED", "SOURCE_PROVIDER_REJECTED", "SOURCE_PROVIDER_TIMEOUT", "SOURCE_PROVIDER_UNAVAILABLE", "SOURCE_SECRET_INTEGRITY_FAILED", "SOURCE_SECRET_REF_CONFLICT", "SOURCE_SYNC_FAILED", "SOURCE_SYNC_SELECTION_MISMATCH", "SOURCE_WEBSITE_CRAWL_CONFIG_INVALID", "SOURCE_WEBSITE_CRAWL_FAILED", "SOURCE_WORKFLOW_CONTENT_MISSING", "SOURCE_WORKFLOW_CONTENT_TOO_LARGE", "SOURCE_WORKFLOW_EXTERNAL_TIMEOUT", "SOURCE_WORKFLOW_FAILED", "UPLOAD_INITIALIZATION_FAILED", "UPLOAD_INTEGRITY_MISMATCH" | *Enum:* `"DOCUMENT_COMPILATION_FAILED"`, `"DOCUMENT_COMPILATION_LEASE_LOST"`, `"DOCUMENT_COMPILATION_RETRYABLE"`, `"DOCUMENT_DISABLED"`, `"DOCUMENT_PARSER_INPUT_INVALID"`, `"DOCUMENT_PARSER_NOT_CONFIGURED"`, `"DOCUMENT_PARSER_RATE_LIMITED"`, `"DOCUMENT_PARSER_RESPONSE_INVALID"`, `"DOCUMENT_PARSER_TIMEOUT"`, `"DOCUMENT_PARSER_UNAVAILABLE"`, `"DOCUMENT_PARSER_UNSUPPORTED_TYPE"`, `"DOCUMENT_PDF_RENDER_FAILED"`, `"EMBEDDING_DIMENSION_INVALID"`, `"EMBEDDING_DIMENSION_UNSUPPORTED"`, `"EXECUTION_ATTEMPTS_EXHAUSTED"`, `"KNOWLEDGE_FS_ACCESS_DENIED"`, `"KNOWLEDGE_FS_CONFLICT"`, `"KNOWLEDGE_FS_INTERNAL_ERROR"`, `"KNOWLEDGE_FS_INVALID_REQUEST"`, `"KNOWLEDGE_FS_NOT_FOUND"`, `"KNOWLEDGE_FS_RATE_LIMITED"`, `"KNOWLEDGE_FS_TIMEOUT"`, `"KNOWLEDGE_FS_UNAVAILABLE"`, `"KNOWLEDGE_SPACE_MANIFEST_NOT_FOUND"`, `"KNOWLEDGE_SPACE_MODEL_CONFIGURATION_REQUIRED"`, `"MODEL_CAPABILITY_MISMATCH"`, `"MODEL_CONFIGURATION_STALE"`, `"MODEL_CREDENTIAL_INVALID"`, `"MODEL_CREDENTIAL_VALIDATION_UNAVAILABLE"`, `"MODEL_IDENTITY_MISMATCH"`, `"MODEL_PREFLIGHT_CANCELED"`, `"MODEL_PREFLIGHT_FAILED"`, `"MODEL_PREFLIGHT_TIMEOUT"`, `"MODEL_PREFLIGHT_UNAVAILABLE"`, `"MODEL_PROFILE_ACTIVATION_INCOMPLETE"`, `"MODEL_PROFILE_ACTIVATION_PERMISSION_REQUIRED"`, `"MODEL_RUNTIME_FAILED"`, `"MODEL_RUNTIME_RESPONSE_INVALID"`, `"MODEL_RUNTIME_TIMEOUT"`, `"MODEL_RUNTIME_UNAVAILABLE"`, `"MODEL_SELECTION_NOT_FOUND"`, `"RESEARCH_TASK_CAPABILITY_REVOKED"`, `"RESEARCH_TASK_DISPATCH_DEAD"`, `"RESEARCH_TASK_EXECUTION_ATTEMPTS_EXHAUSTED"`, `"RESEARCH_TASK_FAILED"`, `"RESEARCH_TASK_PERMISSION_SNAPSHOT_INVALID"`, `"RESEARCH_TASK_RUNTIME_SNAPSHOT_INVALID"`, `"RETRIEVAL_DELETION_IN_PROGRESS"`, `"RETRIEVAL_EXECUTION_LEASE_LOST"`, `"SOURCE_BULK_ACTION_FAILED"`, `"SOURCE_CONNECTION_UNAVAILABLE"`, `"SOURCE_CRAWL_PAGE_NOT_FOUND"`, `"SOURCE_CRAWL_PROVIDER_UNAVAILABLE"`, `"SOURCE_CRAWL_RESULT_LIMIT_EXCEEDED"`, `"SOURCE_CREDENTIAL_CONFIG_INVALID"`, `"SOURCE_CREDENTIAL_MUTATION_FAILED"`, `"SOURCE_CREDENTIAL_TEST_FAILED"`, `"SOURCE_CREDENTIAL_UNAVAILABLE"`, `"SOURCE_DOCUMENT_COMPILATION_FAILED"`, `"SOURCE_DOCUMENT_MATERIALIZATION_FAILED"`, `"SOURCE_DOCUMENT_REPLACEMENT_SAGA_REQUIRED"`, `"SOURCE_IMPORT_PARTIAL_FAILURE"`, `"SOURCE_ONLINE_DOCUMENT_CONFIG_INVALID"`, `"SOURCE_ONLINE_DOCUMENT_IMPORT_FAILED"`, `"SOURCE_ONLINE_DOCUMENT_PAGE_FETCH_FAILED"`, `"SOURCE_ONLINE_DOCUMENT_REQUEST_FAILED"`, `"SOURCE_ONLINE_DOCUMENT_UNAVAILABLE"`, `"SOURCE_ONLINE_DRIVE_CONFIG_INVALID"`, `"SOURCE_ONLINE_DRIVE_FILE_DOWNLOAD_FAILED"`, `"SOURCE_ONLINE_DRIVE_IMPORT_FAILED"`, `"SOURCE_ONLINE_DRIVE_REQUEST_FAILED"`, `"SOURCE_ONLINE_DRIVE_UNAVAILABLE"`, `"SOURCE_OPERATION_FAILED"`, `"SOURCE_PROVIDER_REJECTED"`, `"SOURCE_PROVIDER_TIMEOUT"`, `"SOURCE_PROVIDER_UNAVAILABLE"`, `"SOURCE_SECRET_INTEGRITY_FAILED"`, `"SOURCE_SECRET_REF_CONFLICT"`, `"SOURCE_SYNC_FAILED"`, `"SOURCE_SYNC_SELECTION_MISMATCH"`, `"SOURCE_WEBSITE_CRAWL_CONFIG_INVALID"`, `"SOURCE_WEBSITE_CRAWL_FAILED"`, `"SOURCE_WORKFLOW_CONTENT_MISSING"`, `"SOURCE_WORKFLOW_CONTENT_TOO_LARGE"`, `"SOURCE_WORKFLOW_EXTERNAL_TIMEOUT"`, `"SOURCE_WORKFLOW_FAILED"`, `"UPLOAD_INITIALIZATION_FAILED"`, `"UPLOAD_INTEGRITY_MISMATCH"` | Yes |
|
|
| message | string | | Yes |
|
|
| parameters | object | | No |
|
|
| retryPolicy | string, <br>**Available values:** "after_configuration", "automatic", "manual", "never" | *Enum:* `"after_configuration"`, `"automatic"`, `"manual"`, `"never"` | Yes |
|
|
| stage | string | | No |
|
|
| traceId | string | | No |
|
|
|
|
#### KnowledgeFSQueryAdmissionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expires_at | dateTime | | Yes |
|
|
| operation_id | string | | Yes |
|
|
| request | [KnowledgeFSAdmittedQueryRequest](#knowledgefsadmittedqueryrequest) | | Yes |
|
|
| token | string | | Yes |
|
|
| url | string | | Yes |
|
|
|
|
#### KnowledgeFSQueryCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| activeDocumentIds | [ string ] | | No |
|
|
| activeEntityIds | [ string ] | | No |
|
|
| mode | string, <br>**Available values:** "auto", "deep", "fast", "research" | | No |
|
|
| query | string | | No |
|
|
| queryImages | [ [KnowledgeFSQueryImageReference](#knowledgefsqueryimagereference) ] | | No |
|
|
| sessionId | string | | No |
|
|
|
|
#### KnowledgeFSQueryImageReference
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| uploadFileId | string | | Yes |
|
|
|
|
#### KnowledgeFSQueryImageResponse
|
|
|
|
One query image a retrieval run was asked with, enriched for console display.
|
|
|
|
The gateway persists only the UploadFile reference and static metadata; the console fills in
|
|
the file name and a short-lived signed preview URL for files the caller still owns.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| byte_size | integer | | No |
|
|
| mime_type | string | | No |
|
|
| name | string | | No |
|
|
| preview_url | string | | No |
|
|
| upload_file_id | string | | Yes |
|
|
|
|
#### KnowledgeFSReadinessCapabilities
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| deep | boolean | | Yes |
|
|
| index | boolean | | Yes |
|
|
| ingest | boolean | | Yes |
|
|
| query | boolean | | Yes |
|
|
| research | boolean | | Yes |
|
|
| source_sync | boolean | | Yes |
|
|
|
|
#### KnowledgeFSReadinessIssue
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string, <br>**Available values:** "binding_missing", "incompatible", "missing", "unavailable", "validation_failed" | *Enum:* `"binding_missing"`, `"incompatible"`, `"missing"`, `"unavailable"`, `"validation_failed"` | Yes |
|
|
| field | string, <br>**Available values:** "embedding", "publication", "reasoning", "rerank" | *Enum:* `"embedding"`, `"publication"`, `"reasoning"`, `"rerank"` | Yes |
|
|
| retryable | boolean | | Yes |
|
|
|
|
#### KnowledgeFSResearchTaskCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| budgetUsd | number | | No |
|
|
| limits | [KnowledgeFSResearchTaskLimits](#knowledgefsresearchtasklimits) | | No |
|
|
| metadata | object | | No |
|
|
| mode | string, <br>**Available values:** "auto", "deep", "fast", "research" | | No |
|
|
| query | string | | No |
|
|
| queryImages | [ [KnowledgeFSQueryImageReference](#knowledgefsqueryimagereference) ] | | No |
|
|
| topK | integer | | No |
|
|
|
|
#### KnowledgeFSResearchTaskLimits
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| maxRetrievalSteps | integer | | No |
|
|
| maxScannedResources | integer | | No |
|
|
| maxToolCalls | integer | | No |
|
|
| timeoutMs | integer | | No |
|
|
|
|
#### KnowledgeFSResearchTaskListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSResearchTaskPartialListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSResearchTaskPartialResponse](#knowledgefsresearchtaskpartialresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSResearchTaskPartialResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | No |
|
|
| evidence_bundle | object | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| research_task_job_id | string | | Yes |
|
|
| sequence | integer | | Yes |
|
|
|
|
#### KnowledgeFSResearchTaskPartialsQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
| limit | integer, <br>**Default:** 25 | | No |
|
|
|
|
#### KnowledgeFSResearchTaskPlanBudgetResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| budget_usd | number | | No |
|
|
| exceeds_budget | boolean | | Yes |
|
|
| remaining_budget_usd | number | | No |
|
|
|
|
#### KnowledgeFSResearchTaskPlanPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| budgetUsd | number | | No |
|
|
| mode | string, <br>**Available values:** "auto", "deep", "fast", "research" | | No |
|
|
| query | string | | No |
|
|
| queryImages | [ [KnowledgeFSQueryImageReference](#knowledgefsqueryimagereference) ] | | No |
|
|
| topK | integer | | No |
|
|
|
|
#### KnowledgeFSResearchTaskPlanResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| budget | [KnowledgeFSResearchTaskPlanBudgetResponse](#knowledgefsresearchtaskplanbudgetresponse) | | Yes |
|
|
| estimates | object | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| query | string | | Yes |
|
|
| query_images | [ [KnowledgeFSQueryImageReference](#knowledgefsqueryimagereference) ] | | No |
|
|
| retrieval_plan | [KnowledgeFSResearchTaskRetrievalPlanResponse](#knowledgefsresearchtaskretrievalplanresponse) | | Yes |
|
|
| steps | [ object ] | | Yes |
|
|
| strategy_version | string | | Yes |
|
|
|
|
#### KnowledgeFSResearchTaskResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| budget_usd | number | | No |
|
|
| completed_at | number | | No |
|
|
| cost | object | | Yes |
|
|
| created_at | number | | Yes |
|
|
| error | string | | No |
|
|
| failure | [KnowledgeFSPublicFailureResponse](#knowledgefspublicfailureresponse) | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| limits | [KnowledgeFSResearchTaskLimits](#knowledgefsresearchtasklimits) | | No |
|
|
| metadata | object | | Yes |
|
|
| mode | string, <br>**Available values:** "auto", "deep", "fast", "research" | | No |
|
|
| query | string | | Yes |
|
|
| query_images | [ [KnowledgeFSQueryImageResponse](#knowledgefsqueryimageresponse) ] | | No |
|
|
| stage | string, <br>**Available values:** "analyzing", "canceled", "completed", "failed", "generating", "paused", "planning", "queued", "retrieving" | *Enum:* `"analyzing"`, `"canceled"`, `"completed"`, `"failed"`, `"generating"`, `"paused"`, `"planning"`, `"queued"`, `"retrieving"` | Yes |
|
|
| top_k | integer | | No |
|
|
| updated_at | number | | Yes |
|
|
|
|
#### KnowledgeFSResearchTaskRetrievalPlanResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| dense_top_k | integer | | Yes |
|
|
| fts_top_k | integer | | Yes |
|
|
| fusion_limit | integer | | Yes |
|
|
| query_language | string, <br>**Available values:** "cjk", "latin", "mixed-cjk-latin", "other" | *Enum:* `"cjk"`, `"latin"`, `"mixed-cjk-latin"`, `"other"` | Yes |
|
|
| requested_mode | string, <br>**Available values:** "auto", "deep", "fast", "research" | *Enum:* `"auto"`, `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| rerank_candidate_limit | integer | | Yes |
|
|
| resolved_mode | string, <br>**Available values:** "deep", "fast", "research" | *Enum:* `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| strategy_version | string | | Yes |
|
|
| top_k | integer | | Yes |
|
|
|
|
#### KnowledgeFSRetrievalSettingsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default_mode | string, <br>**Available values:** "deep", "fast", "research" | *Enum:* `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| reasoning_model | [KnowledgeFSEmbeddingSettingsResponse](#knowledgefsembeddingsettingsresponse) | | Yes |
|
|
| rerank | [KnowledgeFSProductRerankProfile](#knowledgefsproductrerankprofile) | | Yes |
|
|
| revision | integer | | No |
|
|
| score_threshold | [KnowledgeFSProductScoreThreshold](#knowledgefsproductscorethreshold) | | Yes |
|
|
| top_k | integer | | Yes |
|
|
|
|
#### KnowledgeFSSettingsPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding | [KnowledgeFSProfileModelSelection](#knowledgefsprofilemodelselection) | | No |
|
|
| expectedRevision | integer | | Yes |
|
|
| retrieval | [KnowledgeFSProductRetrievalProfile](#knowledgefsproductretrievalprofile) | | No |
|
|
|
|
#### KnowledgeFSSettingsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| active_profile_available | boolean | | Yes |
|
|
| active_profile_revisions | [KnowledgeFSActiveProfileRevisions](#knowledgefsactiveprofilerevisions) | | Yes |
|
|
| capabilities | [KnowledgeFSReadinessCapabilities](#knowledgefsreadinesscapabilities) | | Yes |
|
|
| configuration_state | string, <br>**Available values:** "active", "pending-validation", "setup-required", "validation-failed" | *Enum:* `"active"`, `"pending-validation"`, `"setup-required"`, `"validation-failed"` | Yes |
|
|
| embedding | [KnowledgeFSEmbeddingSettingsResponse](#knowledgefsembeddingsettingsresponse) | | Yes |
|
|
| issues | [ [KnowledgeFSReadinessIssue](#knowledgefsreadinessissue) ] | | Yes |
|
|
| retrieval | [KnowledgeFSRetrievalSettingsResponse](#knowledgefsretrievalsettingsresponse) | | Yes |
|
|
| revision | integer | | Yes |
|
|
|
|
#### KnowledgeFSSourceCrawlResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completed | integer | | No |
|
|
| failed | integer | | No |
|
|
| imported | integer | | No |
|
|
| pages | [ [KnowledgeFSCrawledPageResponse](#knowledgefscrawledpageresponse) ] | | Yes |
|
|
| replaced | integer | | No |
|
|
| skipped | integer | | No |
|
|
| status | string | | No |
|
|
| total | integer | | No |
|
|
|
|
#### KnowledgeFSSourceCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| connectionId | string | | No |
|
|
| credentials | object | | No |
|
|
| metadata | object | | No |
|
|
| name | string | | Yes |
|
|
| permissionScope | [ string ] | | No |
|
|
| status | string, <br>**Available values:** "active", "disabled", "error", "syncing" | | No |
|
|
| type | string, <br>**Available values:** "connector", "object-storage", "upload", "web" | *Enum:* `"connector"`, `"object-storage"`, `"upload"`, `"web"` | Yes |
|
|
| uri | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceCredentialTestResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string, <br>**Available values:** "DOCUMENT_COMPILATION_FAILED", "DOCUMENT_COMPILATION_LEASE_LOST", "DOCUMENT_COMPILATION_RETRYABLE", "DOCUMENT_DISABLED", "DOCUMENT_PARSER_INPUT_INVALID", "DOCUMENT_PARSER_NOT_CONFIGURED", "DOCUMENT_PARSER_RATE_LIMITED", "DOCUMENT_PARSER_RESPONSE_INVALID", "DOCUMENT_PARSER_TIMEOUT", "DOCUMENT_PARSER_UNAVAILABLE", "DOCUMENT_PARSER_UNSUPPORTED_TYPE", "DOCUMENT_PDF_RENDER_FAILED", "EMBEDDING_DIMENSION_INVALID", "EMBEDDING_DIMENSION_UNSUPPORTED", "EXECUTION_ATTEMPTS_EXHAUSTED", "KNOWLEDGE_FS_ACCESS_DENIED", "KNOWLEDGE_FS_CONFLICT", "KNOWLEDGE_FS_INTERNAL_ERROR", "KNOWLEDGE_FS_INVALID_REQUEST", "KNOWLEDGE_FS_NOT_FOUND", "KNOWLEDGE_FS_RATE_LIMITED", "KNOWLEDGE_FS_TIMEOUT", "KNOWLEDGE_FS_UNAVAILABLE", "KNOWLEDGE_SPACE_MANIFEST_NOT_FOUND", "KNOWLEDGE_SPACE_MODEL_CONFIGURATION_REQUIRED", "MODEL_CAPABILITY_MISMATCH", "MODEL_CONFIGURATION_STALE", "MODEL_CREDENTIAL_INVALID", "MODEL_CREDENTIAL_VALIDATION_UNAVAILABLE", "MODEL_IDENTITY_MISMATCH", "MODEL_PREFLIGHT_CANCELED", "MODEL_PREFLIGHT_FAILED", "MODEL_PREFLIGHT_TIMEOUT", "MODEL_PREFLIGHT_UNAVAILABLE", "MODEL_PROFILE_ACTIVATION_INCOMPLETE", "MODEL_PROFILE_ACTIVATION_PERMISSION_REQUIRED", "MODEL_RUNTIME_FAILED", "MODEL_RUNTIME_RESPONSE_INVALID", "MODEL_RUNTIME_TIMEOUT", "MODEL_RUNTIME_UNAVAILABLE", "MODEL_SELECTION_NOT_FOUND", "RESEARCH_TASK_CAPABILITY_REVOKED", "RESEARCH_TASK_DISPATCH_DEAD", "RESEARCH_TASK_EXECUTION_ATTEMPTS_EXHAUSTED", "RESEARCH_TASK_FAILED", "RESEARCH_TASK_PERMISSION_SNAPSHOT_INVALID", "RESEARCH_TASK_RUNTIME_SNAPSHOT_INVALID", "RETRIEVAL_DELETION_IN_PROGRESS", "RETRIEVAL_EXECUTION_LEASE_LOST", "SOURCE_BULK_ACTION_FAILED", "SOURCE_CONNECTION_UNAVAILABLE", "SOURCE_CRAWL_PAGE_NOT_FOUND", "SOURCE_CRAWL_PROVIDER_UNAVAILABLE", "SOURCE_CRAWL_RESULT_LIMIT_EXCEEDED", "SOURCE_CREDENTIAL_CONFIG_INVALID", "SOURCE_CREDENTIAL_MUTATION_FAILED", "SOURCE_CREDENTIAL_TEST_FAILED", "SOURCE_CREDENTIAL_UNAVAILABLE", "SOURCE_DOCUMENT_COMPILATION_FAILED", "SOURCE_DOCUMENT_MATERIALIZATION_FAILED", "SOURCE_DOCUMENT_REPLACEMENT_SAGA_REQUIRED", "SOURCE_IMPORT_PARTIAL_FAILURE", "SOURCE_ONLINE_DOCUMENT_CONFIG_INVALID", "SOURCE_ONLINE_DOCUMENT_IMPORT_FAILED", "SOURCE_ONLINE_DOCUMENT_PAGE_FETCH_FAILED", "SOURCE_ONLINE_DOCUMENT_REQUEST_FAILED", "SOURCE_ONLINE_DOCUMENT_UNAVAILABLE", "SOURCE_ONLINE_DRIVE_CONFIG_INVALID", "SOURCE_ONLINE_DRIVE_FILE_DOWNLOAD_FAILED", "SOURCE_ONLINE_DRIVE_IMPORT_FAILED", "SOURCE_ONLINE_DRIVE_REQUEST_FAILED", "SOURCE_ONLINE_DRIVE_UNAVAILABLE", "SOURCE_OPERATION_FAILED", "SOURCE_PROVIDER_REJECTED", "SOURCE_PROVIDER_TIMEOUT", "SOURCE_PROVIDER_UNAVAILABLE", "SOURCE_SECRET_INTEGRITY_FAILED", "SOURCE_SECRET_REF_CONFLICT", "SOURCE_SYNC_FAILED", "SOURCE_SYNC_SELECTION_MISMATCH", "SOURCE_WEBSITE_CRAWL_CONFIG_INVALID", "SOURCE_WEBSITE_CRAWL_FAILED", "SOURCE_WORKFLOW_CONTENT_MISSING", "SOURCE_WORKFLOW_CONTENT_TOO_LARGE", "SOURCE_WORKFLOW_EXTERNAL_TIMEOUT", "SOURCE_WORKFLOW_FAILED", "UPLOAD_INITIALIZATION_FAILED", "UPLOAD_INTEGRITY_MISMATCH" | | No |
|
|
| error | string | | No |
|
|
| failure | [KnowledgeFSPublicFailureResponse](#knowledgefspublicfailureresponse) | | No |
|
|
| valid | boolean | | Yes |
|
|
|
|
#### KnowledgeFSSourceDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expectedRevision | integer | | Yes |
|
|
|
|
#### KnowledgeFSSourceDeleteQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| documents | string, <br>**Available values:** "cascade", "keep", <br>**Default:** cascade | *Enum:* `"cascade"`, `"keep"` | No |
|
|
|
|
#### KnowledgeFSSourceEditOnlineDocumentSelectionPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [KnowledgeFSOnlineDocumentWorkflowImportItemPayload](#knowledgefsonlinedocumentworkflowimportitempayload) ] | | Yes |
|
|
| kind | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceEditOnlineDriveSelectionPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [KnowledgeFSOnlineDriveWorkflowImportItemPayload](#knowledgefsonlinedriveworkflowimportitempayload) ] | | Yes |
|
|
| kind | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceEditSyncPolicyPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| customIntervalSeconds | integer | | No |
|
|
| enabled | boolean | | Yes |
|
|
| mode | string, <br>**Available values:** "custom", "interval", "manual" | *Enum:* `"custom"`, `"interval"`, `"manual"` | Yes |
|
|
|
|
#### KnowledgeFSSourceEditWebsiteSelectionPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| kind | string | | Yes |
|
|
| sourceUrls | [ string ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceFileBucketResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| bucket | string | | No |
|
|
| continuation_token | string | | No |
|
|
| files | [ [KnowledgeFSSourceFileResponse](#knowledgefssourcefileresponse) ] | | Yes |
|
|
| is_truncated | boolean | | No |
|
|
|
|
#### KnowledgeFSSourceFileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| size | number | | No |
|
|
| type | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceFilesQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| bucket | string | | No |
|
|
| continuationToken | string | | No |
|
|
| maxKeys | integer | | No |
|
|
| prefix | string | | No |
|
|
|
|
#### KnowledgeFSSourceFilesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| buckets | [ [KnowledgeFSSourceFileBucketResponse](#knowledgefssourcefilebucketresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportFailureResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string, <br>**Available values:** "DOCUMENT_COMPILATION_FAILED", "DOCUMENT_COMPILATION_LEASE_LOST", "DOCUMENT_COMPILATION_RETRYABLE", "DOCUMENT_DISABLED", "DOCUMENT_PARSER_INPUT_INVALID", "DOCUMENT_PARSER_NOT_CONFIGURED", "DOCUMENT_PARSER_RATE_LIMITED", "DOCUMENT_PARSER_RESPONSE_INVALID", "DOCUMENT_PARSER_TIMEOUT", "DOCUMENT_PARSER_UNAVAILABLE", "DOCUMENT_PARSER_UNSUPPORTED_TYPE", "DOCUMENT_PDF_RENDER_FAILED", "EMBEDDING_DIMENSION_INVALID", "EMBEDDING_DIMENSION_UNSUPPORTED", "EXECUTION_ATTEMPTS_EXHAUSTED", "KNOWLEDGE_FS_ACCESS_DENIED", "KNOWLEDGE_FS_CONFLICT", "KNOWLEDGE_FS_INTERNAL_ERROR", "KNOWLEDGE_FS_INVALID_REQUEST", "KNOWLEDGE_FS_NOT_FOUND", "KNOWLEDGE_FS_RATE_LIMITED", "KNOWLEDGE_FS_TIMEOUT", "KNOWLEDGE_FS_UNAVAILABLE", "KNOWLEDGE_SPACE_MANIFEST_NOT_FOUND", "KNOWLEDGE_SPACE_MODEL_CONFIGURATION_REQUIRED", "MODEL_CAPABILITY_MISMATCH", "MODEL_CONFIGURATION_STALE", "MODEL_CREDENTIAL_INVALID", "MODEL_CREDENTIAL_VALIDATION_UNAVAILABLE", "MODEL_IDENTITY_MISMATCH", "MODEL_PREFLIGHT_CANCELED", "MODEL_PREFLIGHT_FAILED", "MODEL_PREFLIGHT_TIMEOUT", "MODEL_PREFLIGHT_UNAVAILABLE", "MODEL_PROFILE_ACTIVATION_INCOMPLETE", "MODEL_PROFILE_ACTIVATION_PERMISSION_REQUIRED", "MODEL_RUNTIME_FAILED", "MODEL_RUNTIME_RESPONSE_INVALID", "MODEL_RUNTIME_TIMEOUT", "MODEL_RUNTIME_UNAVAILABLE", "MODEL_SELECTION_NOT_FOUND", "RESEARCH_TASK_CAPABILITY_REVOKED", "RESEARCH_TASK_DISPATCH_DEAD", "RESEARCH_TASK_EXECUTION_ATTEMPTS_EXHAUSTED", "RESEARCH_TASK_FAILED", "RESEARCH_TASK_PERMISSION_SNAPSHOT_INVALID", "RESEARCH_TASK_RUNTIME_SNAPSHOT_INVALID", "RETRIEVAL_DELETION_IN_PROGRESS", "RETRIEVAL_EXECUTION_LEASE_LOST", "SOURCE_BULK_ACTION_FAILED", "SOURCE_CONNECTION_UNAVAILABLE", "SOURCE_CRAWL_PAGE_NOT_FOUND", "SOURCE_CRAWL_PROVIDER_UNAVAILABLE", "SOURCE_CRAWL_RESULT_LIMIT_EXCEEDED", "SOURCE_CREDENTIAL_CONFIG_INVALID", "SOURCE_CREDENTIAL_MUTATION_FAILED", "SOURCE_CREDENTIAL_TEST_FAILED", "SOURCE_CREDENTIAL_UNAVAILABLE", "SOURCE_DOCUMENT_COMPILATION_FAILED", "SOURCE_DOCUMENT_MATERIALIZATION_FAILED", "SOURCE_DOCUMENT_REPLACEMENT_SAGA_REQUIRED", "SOURCE_IMPORT_PARTIAL_FAILURE", "SOURCE_ONLINE_DOCUMENT_CONFIG_INVALID", "SOURCE_ONLINE_DOCUMENT_IMPORT_FAILED", "SOURCE_ONLINE_DOCUMENT_PAGE_FETCH_FAILED", "SOURCE_ONLINE_DOCUMENT_REQUEST_FAILED", "SOURCE_ONLINE_DOCUMENT_UNAVAILABLE", "SOURCE_ONLINE_DRIVE_CONFIG_INVALID", "SOURCE_ONLINE_DRIVE_FILE_DOWNLOAD_FAILED", "SOURCE_ONLINE_DRIVE_IMPORT_FAILED", "SOURCE_ONLINE_DRIVE_REQUEST_FAILED", "SOURCE_ONLINE_DRIVE_UNAVAILABLE", "SOURCE_OPERATION_FAILED", "SOURCE_PROVIDER_REJECTED", "SOURCE_PROVIDER_TIMEOUT", "SOURCE_PROVIDER_UNAVAILABLE", "SOURCE_SECRET_INTEGRITY_FAILED", "SOURCE_SECRET_REF_CONFLICT", "SOURCE_SYNC_FAILED", "SOURCE_SYNC_SELECTION_MISMATCH", "SOURCE_WEBSITE_CRAWL_CONFIG_INVALID", "SOURCE_WEBSITE_CRAWL_FAILED", "SOURCE_WORKFLOW_CONTENT_MISSING", "SOURCE_WORKFLOW_CONTENT_TOO_LARGE", "SOURCE_WORKFLOW_EXTERNAL_TIMEOUT", "SOURCE_WORKFLOW_FAILED", "UPLOAD_INITIALIZATION_FAILED", "UPLOAD_INTEGRITY_MISMATCH" | *Enum:* `"DOCUMENT_COMPILATION_FAILED"`, `"DOCUMENT_COMPILATION_LEASE_LOST"`, `"DOCUMENT_COMPILATION_RETRYABLE"`, `"DOCUMENT_DISABLED"`, `"DOCUMENT_PARSER_INPUT_INVALID"`, `"DOCUMENT_PARSER_NOT_CONFIGURED"`, `"DOCUMENT_PARSER_RATE_LIMITED"`, `"DOCUMENT_PARSER_RESPONSE_INVALID"`, `"DOCUMENT_PARSER_TIMEOUT"`, `"DOCUMENT_PARSER_UNAVAILABLE"`, `"DOCUMENT_PARSER_UNSUPPORTED_TYPE"`, `"DOCUMENT_PDF_RENDER_FAILED"`, `"EMBEDDING_DIMENSION_INVALID"`, `"EMBEDDING_DIMENSION_UNSUPPORTED"`, `"EXECUTION_ATTEMPTS_EXHAUSTED"`, `"KNOWLEDGE_FS_ACCESS_DENIED"`, `"KNOWLEDGE_FS_CONFLICT"`, `"KNOWLEDGE_FS_INTERNAL_ERROR"`, `"KNOWLEDGE_FS_INVALID_REQUEST"`, `"KNOWLEDGE_FS_NOT_FOUND"`, `"KNOWLEDGE_FS_RATE_LIMITED"`, `"KNOWLEDGE_FS_TIMEOUT"`, `"KNOWLEDGE_FS_UNAVAILABLE"`, `"KNOWLEDGE_SPACE_MANIFEST_NOT_FOUND"`, `"KNOWLEDGE_SPACE_MODEL_CONFIGURATION_REQUIRED"`, `"MODEL_CAPABILITY_MISMATCH"`, `"MODEL_CONFIGURATION_STALE"`, `"MODEL_CREDENTIAL_INVALID"`, `"MODEL_CREDENTIAL_VALIDATION_UNAVAILABLE"`, `"MODEL_IDENTITY_MISMATCH"`, `"MODEL_PREFLIGHT_CANCELED"`, `"MODEL_PREFLIGHT_FAILED"`, `"MODEL_PREFLIGHT_TIMEOUT"`, `"MODEL_PREFLIGHT_UNAVAILABLE"`, `"MODEL_PROFILE_ACTIVATION_INCOMPLETE"`, `"MODEL_PROFILE_ACTIVATION_PERMISSION_REQUIRED"`, `"MODEL_RUNTIME_FAILED"`, `"MODEL_RUNTIME_RESPONSE_INVALID"`, `"MODEL_RUNTIME_TIMEOUT"`, `"MODEL_RUNTIME_UNAVAILABLE"`, `"MODEL_SELECTION_NOT_FOUND"`, `"RESEARCH_TASK_CAPABILITY_REVOKED"`, `"RESEARCH_TASK_DISPATCH_DEAD"`, `"RESEARCH_TASK_EXECUTION_ATTEMPTS_EXHAUSTED"`, `"RESEARCH_TASK_FAILED"`, `"RESEARCH_TASK_PERMISSION_SNAPSHOT_INVALID"`, `"RESEARCH_TASK_RUNTIME_SNAPSHOT_INVALID"`, `"RETRIEVAL_DELETION_IN_PROGRESS"`, `"RETRIEVAL_EXECUTION_LEASE_LOST"`, `"SOURCE_BULK_ACTION_FAILED"`, `"SOURCE_CONNECTION_UNAVAILABLE"`, `"SOURCE_CRAWL_PAGE_NOT_FOUND"`, `"SOURCE_CRAWL_PROVIDER_UNAVAILABLE"`, `"SOURCE_CRAWL_RESULT_LIMIT_EXCEEDED"`, `"SOURCE_CREDENTIAL_CONFIG_INVALID"`, `"SOURCE_CREDENTIAL_MUTATION_FAILED"`, `"SOURCE_CREDENTIAL_TEST_FAILED"`, `"SOURCE_CREDENTIAL_UNAVAILABLE"`, `"SOURCE_DOCUMENT_COMPILATION_FAILED"`, `"SOURCE_DOCUMENT_MATERIALIZATION_FAILED"`, `"SOURCE_DOCUMENT_REPLACEMENT_SAGA_REQUIRED"`, `"SOURCE_IMPORT_PARTIAL_FAILURE"`, `"SOURCE_ONLINE_DOCUMENT_CONFIG_INVALID"`, `"SOURCE_ONLINE_DOCUMENT_IMPORT_FAILED"`, `"SOURCE_ONLINE_DOCUMENT_PAGE_FETCH_FAILED"`, `"SOURCE_ONLINE_DOCUMENT_REQUEST_FAILED"`, `"SOURCE_ONLINE_DOCUMENT_UNAVAILABLE"`, `"SOURCE_ONLINE_DRIVE_CONFIG_INVALID"`, `"SOURCE_ONLINE_DRIVE_FILE_DOWNLOAD_FAILED"`, `"SOURCE_ONLINE_DRIVE_IMPORT_FAILED"`, `"SOURCE_ONLINE_DRIVE_REQUEST_FAILED"`, `"SOURCE_ONLINE_DRIVE_UNAVAILABLE"`, `"SOURCE_OPERATION_FAILED"`, `"SOURCE_PROVIDER_REJECTED"`, `"SOURCE_PROVIDER_TIMEOUT"`, `"SOURCE_PROVIDER_UNAVAILABLE"`, `"SOURCE_SECRET_INTEGRITY_FAILED"`, `"SOURCE_SECRET_REF_CONFLICT"`, `"SOURCE_SYNC_FAILED"`, `"SOURCE_SYNC_SELECTION_MISMATCH"`, `"SOURCE_WEBSITE_CRAWL_CONFIG_INVALID"`, `"SOURCE_WEBSITE_CRAWL_FAILED"`, `"SOURCE_WORKFLOW_CONTENT_MISSING"`, `"SOURCE_WORKFLOW_CONTENT_TOO_LARGE"`, `"SOURCE_WORKFLOW_EXTERNAL_TIMEOUT"`, `"SOURCE_WORKFLOW_FAILED"`, `"UPLOAD_INITIALIZATION_FAILED"`, `"UPLOAD_INTEGRITY_MISMATCH"` | Yes |
|
|
| error | string | | Yes |
|
|
| failure | [KnowledgeFSPublicFailureResponse](#knowledgefspublicfailureresponse) | | No |
|
|
| filename | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportFilePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| bucket | string | | No |
|
|
| id | string | | Yes |
|
|
| mimeType | string | | No |
|
|
| name | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportFilesPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ [KnowledgeFSSourceImportFilePayload](#knowledgefssourceimportfilepayload) ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportPagePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| lastEditedTime | string | | No |
|
|
| name | string | | No |
|
|
| pageId | string | | Yes |
|
|
| type | string | | Yes |
|
|
| workspaceId | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportPagesPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| pages | [ [KnowledgeFSSourceImportPagePayload](#knowledgefssourceimportpagepayload) ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| documents | [ [KnowledgeFSSourceImportedDocumentResponse](#knowledgefssourceimporteddocumentresponse) ] | | Yes |
|
|
| failed | [ [KnowledgeFSSourceImportFailureResponse](#knowledgefssourceimportfailureresponse) ] | | Yes |
|
|
| skipped | [ string ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportedDocumentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_asset_id | string | | Yes |
|
|
| filename | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSSourceResponse](#knowledgefssourceresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSSourcePageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| last_edited_time | string | | No |
|
|
| page_id | string | | Yes |
|
|
| page_name | string | | Yes |
|
|
| parent_id | string | | No |
|
|
| type | string | | Yes |
|
|
|
|
#### KnowledgeFSSourcePagesQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
| limit | integer, <br>**Default:** 50 | | No |
|
|
|
|
#### KnowledgeFSSourcePagesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| next_cursor | string | | No |
|
|
| workspaces | [ [KnowledgeFSSourceWorkspacePagesResponse](#knowledgefssourceworkspacepagesresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| connection_id | string | | No |
|
|
| created_at | dateTime | | Yes |
|
|
| credential_configured | boolean | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| last_synced_at | string | | No |
|
|
| metadata | object | | Yes |
|
|
| name | string | | Yes |
|
|
| permission_scope | [ string ] | | Yes |
|
|
| status | string, <br>**Available values:** "active", "disabled", "error", "syncing" | *Enum:* `"active"`, `"disabled"`, `"error"`, `"syncing"` | Yes |
|
|
| sync_policy | [KnowledgeFSSourceSyncPolicyResponse](#knowledgefssourcesyncpolicyresponse) | | No |
|
|
| sync_workflow | [KnowledgeFSSourceWorkflowResponse](#knowledgefssourceworkflowresponse) | | No |
|
|
| type | string, <br>**Available values:** "connector", "object-storage", "upload", "web" | *Enum:* `"connector"`, `"object-storage"`, `"upload"`, `"web"` | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
| uri | string | | Yes |
|
|
| version | integer | | Yes |
|
|
|
|
#### KnowledgeFSSourceSyncPolicyResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | dateTime | | Yes |
|
|
| custom_interval_seconds | integer | | No |
|
|
| enabled | boolean | | Yes |
|
|
| expected_source_version | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| mode | string, <br>**Available values:** "custom", "interval", "manual" | *Enum:* `"custom"`, `"interval"`, `"manual"` | Yes |
|
|
| next_run_at | string | | No |
|
|
| revision | integer | | Yes |
|
|
| source_id | string | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
|
|
#### KnowledgeFSSourceUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expectedVersion | integer | | No |
|
|
| metadata | object | | No |
|
|
| name | string | | No |
|
|
| providerParameters | object | | No |
|
|
| selection | [KnowledgeFSSourceEditWebsiteSelectionPayload](#knowledgefssourceeditwebsiteselectionpayload)<br>[KnowledgeFSSourceEditOnlineDocumentSelectionPayload](#knowledgefssourceeditonlinedocumentselectionpayload)<br>[KnowledgeFSSourceEditOnlineDriveSelectionPayload](#knowledgefssourceeditonlinedriveselectionpayload) | | No |
|
|
| status | string, <br>**Available values:** "active", "disabled", "error", "syncing" | | No |
|
|
| syncAfterUpdate | boolean | | No |
|
|
| syncPolicy | [KnowledgeFSSourceEditSyncPolicyPayload](#knowledgefssourceeditsyncpolicypayload) | | No |
|
|
| uri | string | | No |
|
|
|
|
#### KnowledgeFSSourceWorkflowResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| canceled_at | string | | No |
|
|
| checkpoint | string | | Yes |
|
|
| completed_at | string | | No |
|
|
| created_at | dateTime | | Yes |
|
|
| cursor | string | | No |
|
|
| execution_attempts | integer | | Yes |
|
|
| failure | [KnowledgeFSPublicFailureResponse](#knowledgefspublicfailureresponse) | | No |
|
|
| id | string | | Yes |
|
|
| kind | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| last_error_code | string, <br>**Available values:** "DOCUMENT_COMPILATION_FAILED", "DOCUMENT_COMPILATION_LEASE_LOST", "DOCUMENT_COMPILATION_RETRYABLE", "DOCUMENT_DISABLED", "DOCUMENT_PARSER_INPUT_INVALID", "DOCUMENT_PARSER_NOT_CONFIGURED", "DOCUMENT_PARSER_RATE_LIMITED", "DOCUMENT_PARSER_RESPONSE_INVALID", "DOCUMENT_PARSER_TIMEOUT", "DOCUMENT_PARSER_UNAVAILABLE", "DOCUMENT_PARSER_UNSUPPORTED_TYPE", "DOCUMENT_PDF_RENDER_FAILED", "EMBEDDING_DIMENSION_INVALID", "EMBEDDING_DIMENSION_UNSUPPORTED", "EXECUTION_ATTEMPTS_EXHAUSTED", "KNOWLEDGE_FS_ACCESS_DENIED", "KNOWLEDGE_FS_CONFLICT", "KNOWLEDGE_FS_INTERNAL_ERROR", "KNOWLEDGE_FS_INVALID_REQUEST", "KNOWLEDGE_FS_NOT_FOUND", "KNOWLEDGE_FS_RATE_LIMITED", "KNOWLEDGE_FS_TIMEOUT", "KNOWLEDGE_FS_UNAVAILABLE", "KNOWLEDGE_SPACE_MANIFEST_NOT_FOUND", "KNOWLEDGE_SPACE_MODEL_CONFIGURATION_REQUIRED", "MODEL_CAPABILITY_MISMATCH", "MODEL_CONFIGURATION_STALE", "MODEL_CREDENTIAL_INVALID", "MODEL_CREDENTIAL_VALIDATION_UNAVAILABLE", "MODEL_IDENTITY_MISMATCH", "MODEL_PREFLIGHT_CANCELED", "MODEL_PREFLIGHT_FAILED", "MODEL_PREFLIGHT_TIMEOUT", "MODEL_PREFLIGHT_UNAVAILABLE", "MODEL_PROFILE_ACTIVATION_INCOMPLETE", "MODEL_PROFILE_ACTIVATION_PERMISSION_REQUIRED", "MODEL_RUNTIME_FAILED", "MODEL_RUNTIME_RESPONSE_INVALID", "MODEL_RUNTIME_TIMEOUT", "MODEL_RUNTIME_UNAVAILABLE", "MODEL_SELECTION_NOT_FOUND", "RESEARCH_TASK_CAPABILITY_REVOKED", "RESEARCH_TASK_DISPATCH_DEAD", "RESEARCH_TASK_EXECUTION_ATTEMPTS_EXHAUSTED", "RESEARCH_TASK_FAILED", "RESEARCH_TASK_PERMISSION_SNAPSHOT_INVALID", "RESEARCH_TASK_RUNTIME_SNAPSHOT_INVALID", "RETRIEVAL_DELETION_IN_PROGRESS", "RETRIEVAL_EXECUTION_LEASE_LOST", "SOURCE_BULK_ACTION_FAILED", "SOURCE_CONNECTION_UNAVAILABLE", "SOURCE_CRAWL_PAGE_NOT_FOUND", "SOURCE_CRAWL_PROVIDER_UNAVAILABLE", "SOURCE_CRAWL_RESULT_LIMIT_EXCEEDED", "SOURCE_CREDENTIAL_CONFIG_INVALID", "SOURCE_CREDENTIAL_MUTATION_FAILED", "SOURCE_CREDENTIAL_TEST_FAILED", "SOURCE_CREDENTIAL_UNAVAILABLE", "SOURCE_DOCUMENT_COMPILATION_FAILED", "SOURCE_DOCUMENT_MATERIALIZATION_FAILED", "SOURCE_DOCUMENT_REPLACEMENT_SAGA_REQUIRED", "SOURCE_IMPORT_PARTIAL_FAILURE", "SOURCE_ONLINE_DOCUMENT_CONFIG_INVALID", "SOURCE_ONLINE_DOCUMENT_IMPORT_FAILED", "SOURCE_ONLINE_DOCUMENT_PAGE_FETCH_FAILED", "SOURCE_ONLINE_DOCUMENT_REQUEST_FAILED", "SOURCE_ONLINE_DOCUMENT_UNAVAILABLE", "SOURCE_ONLINE_DRIVE_CONFIG_INVALID", "SOURCE_ONLINE_DRIVE_FILE_DOWNLOAD_FAILED", "SOURCE_ONLINE_DRIVE_IMPORT_FAILED", "SOURCE_ONLINE_DRIVE_REQUEST_FAILED", "SOURCE_ONLINE_DRIVE_UNAVAILABLE", "SOURCE_OPERATION_FAILED", "SOURCE_PROVIDER_REJECTED", "SOURCE_PROVIDER_TIMEOUT", "SOURCE_PROVIDER_UNAVAILABLE", "SOURCE_SECRET_INTEGRITY_FAILED", "SOURCE_SECRET_REF_CONFLICT", "SOURCE_SYNC_FAILED", "SOURCE_SYNC_SELECTION_MISMATCH", "SOURCE_WEBSITE_CRAWL_CONFIG_INVALID", "SOURCE_WEBSITE_CRAWL_FAILED", "SOURCE_WORKFLOW_CONTENT_MISSING", "SOURCE_WORKFLOW_CONTENT_TOO_LARGE", "SOURCE_WORKFLOW_EXTERNAL_TIMEOUT", "SOURCE_WORKFLOW_FAILED", "UPLOAD_INITIALIZATION_FAILED", "UPLOAD_INTEGRITY_MISMATCH" | | No |
|
|
| max_execution_attempts | integer | | Yes |
|
|
| progress_completed | integer | | Yes |
|
|
| progress_failed | integer | | Yes |
|
|
| progress_skipped | integer | | Yes |
|
|
| progress_total | integer | | No |
|
|
| source_id | string | | No |
|
|
| state | string | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
|
|
#### KnowledgeFSSourceWorkspacePagesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| pages | [ [KnowledgeFSSourcePageResponse](#knowledgefssourcepageresponse) ] | | Yes |
|
|
| total | integer | | No |
|
|
| workspace_id | string | | No |
|
|
| workspace_name | string | | No |
|
|
|
|
#### KnowledgeFSTraceEntriesQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
| limit | integer, <br>**Default:** 100 | | No |
|
|
|
|
#### KnowledgeFSTraceEntryListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| consistency_class | string | | No |
|
|
| data | [ [KnowledgeFSTraceEntryResponse](#knowledgefstraceentryresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
| path | string | | Yes |
|
|
| preview | boolean | | No |
|
|
| truncated | boolean | | Yes |
|
|
|
|
#### KnowledgeFSTraceEntryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| kind | string, <br>**Available values:** "directory", "resource" | *Enum:* `"directory"`, `"resource"` | Yes |
|
|
| metadata | object | | Yes |
|
|
| name | string | | Yes |
|
|
| path | string | | Yes |
|
|
| resource_type | string | | No |
|
|
| target_id | string | | No |
|
|
| version | integer | | No |
|
|
|
|
#### KnowledgeFSTraceListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSTraceResponse](#knowledgefstraceresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSTraceProfileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding_model | string | | No |
|
|
| embedding_vector_space_id | string | | No |
|
|
| projection_publication_id | string | | No |
|
|
| projection_version | integer | | No |
|
|
| reasoning_model | string | | No |
|
|
| rerank_model | string | | No |
|
|
| retrieval_profile_revision | integer | | No |
|
|
|
|
#### KnowledgeFSTraceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completed | boolean | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| duration_ms | integer | | No |
|
|
| evidence_bundle_id | string | | No |
|
|
| evidence_state | string | | No |
|
|
| final_score | number | | No |
|
|
| id | string | | Yes |
|
|
| mode | string, <br>**Available values:** "auto", "deep", "fast", "research" | *Enum:* `"auto"`, `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| open_bad_case_id | string | | No |
|
|
| profile | [KnowledgeFSTraceProfileResponse](#knowledgefstraceprofileresponse) | | Yes |
|
|
| query | string | | Yes |
|
|
| query_images | [ [KnowledgeFSQueryImageResponse](#knowledgefsqueryimageresponse) ] | | No |
|
|
| result_count | integer | | Yes |
|
|
| scores | [KnowledgeFSTraceScoresResponse](#knowledgefstracescoresresponse) | | Yes |
|
|
| stages | [ [KnowledgeFSTraceStageResponse](#knowledgefstracestageresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSTraceScoresResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| final | number | | No |
|
|
| rerank | number | | No |
|
|
| retrieval | number | | No |
|
|
|
|
#### KnowledgeFSTraceStageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| candidate_count | integer | | No |
|
|
| name | string | | Yes |
|
|
| status | string, <br>**Available values:** "error", "ok", "skipped" | *Enum:* `"error"`, `"ok"`, `"skipped"` | Yes |
|
|
|
|
#### KnowledgeTagListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| KnowledgeTagListResponse | array | | |
|
|
|
|
#### KnowledgeTagResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| binding_count | string | | No |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### MessageFeedbackPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | Optional text feedback providing additional detail. | No |
|
|
| rating | string, <br>**Available values:** "dislike", "like" | Feedback rating. Set to `null` to revoke previously submitted feedback. | No |
|
|
|
|
#### MessageFeedbackPayloadWithUser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | Optional text feedback providing additional detail. | No |
|
|
| rating | string, <br>**Available values:** "dislike", "like" | Feedback rating. Set to `null` to revoke previously submitted feedback. | No |
|
|
| user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | Yes |
|
|
|
|
#### MessageFile
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| belongs_to | string | | No |
|
|
| filename | string | | Yes |
|
|
| id | string (uuid) | | Yes |
|
|
| mime_type | string | | No |
|
|
| size | integer | | No |
|
|
| transfer_method | string | | Yes |
|
|
| type | string | | Yes |
|
|
| upload_file_id | string | | No |
|
|
| url | string | | No |
|
|
|
|
#### MessageInfiniteScrollPagination
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [MessageListItem](#messagelistitem) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
|
|
#### MessageListItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_thoughts | [ [AgentThought](#agentthought) ] | | Yes |
|
|
| answer | string | | Yes |
|
|
| answer_tokens | integer | | No |
|
|
| conversation_id | string (uuid) | | Yes |
|
|
| created_at | integer | | No |
|
|
| currency | string | | No |
|
|
| error | string | | No |
|
|
| extra_contents | [ [HumanInputContent](#humaninputcontent) ] | | Yes |
|
|
| feedback | [SimpleFeedback](#simplefeedback) | | No |
|
|
| id | string (uuid) | | Yes |
|
|
| inputs | object | | Yes |
|
|
| message_files | [ [MessageFile](#messagefile) ] | | Yes |
|
|
| message_tokens | integer | | No |
|
|
| parent_message_id | string | | No |
|
|
| provider_response_latency | float | | No |
|
|
| query | string | | Yes |
|
|
| retriever_resources | [ [RetrieverResource](#retrieverresource) ] | | Yes |
|
|
| status | string | | Yes |
|
|
| total_price | string | | No |
|
|
| total_tokens | integer | | Yes |
|
|
|
|
#### MessageListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | Conversation ID. | Yes |
|
|
| first_id | string | The ID of the first chat record on the current page. Omit this value to fetch the latest messages; for subsequent pages, use the first message ID from the current list to fetch older messages. | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of chat history messages to return per request. | No |
|
|
|
|
#### MetadataArgs
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | Metadata field name. | Yes |
|
|
| type | string, <br>**Available values:** "number", "string", "time" | `string` for text values, `number` for numeric values, `time` for date/time values.<br>*Enum:* `"number"`, `"string"`, `"time"` | Yes |
|
|
|
|
#### MetadataDetail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string (uuid) | Metadata field ID. | Yes |
|
|
| name | string | Metadata field name. | Yes |
|
|
| value | string<br>integer<br>number | Metadata value. Can be a string, number, or `null`. | No |
|
|
|
|
#### MetadataFilteringCondition
|
|
|
|
Metadata Filtering Condition.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conditions | [ [Condition](#condition) ] | List of metadata conditions to evaluate. | No |
|
|
| logical_operator | string, <br>**Available values:** "and", "or" | How to combine multiple conditions. | No |
|
|
|
|
#### MetadataOperationData
|
|
|
|
Metadata operation data
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| operation_data | [ [DocumentMetadataOperation](#documentmetadataoperation) ] | Array of document metadata update operations. Each entry maps a document ID to its metadata values. | Yes |
|
|
|
|
#### MetadataUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | New metadata field name. | Yes |
|
|
|
|
#### ModelFeature
|
|
|
|
Enum class for llm feature.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ModelFeature | string | Enum class for llm feature. | |
|
|
|
|
#### ModelPropertyKey
|
|
|
|
Enum class for model property key.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ModelPropertyKey | string | Enum class for model property key. | |
|
|
|
|
#### ModelStatus
|
|
|
|
Enum class for model status.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ModelStatus | string | Enum class for model status. | |
|
|
|
|
#### ModelType
|
|
|
|
Enum class for model type.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ModelType | string | Enum class for model type. | |
|
|
|
|
#### OptionalServiceApiUserPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | No |
|
|
|
|
#### ParagraphInputConfig
|
|
|
|
Form input definition.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default | [StringSource](#stringsource) | Raw default-value configuration for the paragraph input. Runtime-resolved values are exposed in the surrounding `resolved_default_values` mapping. | No |
|
|
| output_variable_name | string | | Yes |
|
|
| type | string | | No |
|
|
|
|
#### Parameters
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| annotation_reply | { **"enabled"**: boolean } | | Yes |
|
|
| file_upload | { **"allowed_file_extensions"**: [ string ], **"allowed_file_types"**: [ string, <br>**Available values:** "audio", "custom", "document", "image", "video" ], **"allowed_file_upload_methods"**: [ string, <br>**Available values:** "local_file", "remote_url" ], **"enabled"**: boolean, **"image"**: { **"detail"**: string, **"enabled"**: boolean, **"number_limits"**: integer, **"transfer_methods"**: [ string ] }, **"number_limits"**: integer } | | Yes |
|
|
| more_like_this | { **"enabled"**: boolean } | | Yes |
|
|
| opening_statement | | | No |
|
|
| retriever_resource | { **"enabled"**: boolean } | | Yes |
|
|
| sensitive_word_avoidance | { **"enabled"**: boolean } | | Yes |
|
|
| speech_to_text | { **"enabled"**: boolean } | | Yes |
|
|
| suggested_questions | [ string ] | | Yes |
|
|
| suggested_questions_after_answer | { **"enabled"**: boolean } | | Yes |
|
|
| system_parameters | [SystemParameters](#systemparameters) | System-level parameter limits. | Yes |
|
|
| text_to_speech | { **"autoPlay"**: string, **"enabled"**: boolean, **"language"**: string, **"voice"**: string } | | Yes |
|
|
| user_input_form | [ object ] | | Yes |
|
|
|
|
#### PermissionEnum
|
|
|
|
Shared permission levels for resources (datasets, credentials, etc.)
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| PermissionEnum | string | Shared permission levels for resources (datasets, credentials, etc.) | |
|
|
|
|
#### PipelineDataset
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| chunk_structure | string | | Yes |
|
|
| description | string | knowledge dataset description | No |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### PipelineDocument
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data_source_info | object | | No |
|
|
| data_source_type | string | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
| error | string | | No |
|
|
| id | string | | Yes |
|
|
| indexing_status | string | | Yes |
|
|
| name | string | | Yes |
|
|
| position | integer | | Yes |
|
|
|
|
#### PipelineRunApiEntity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| datasource_info_list | [ object<br>object<br>object<br>object ] | List of datasource objects to process. The expected item structure depends on `datasource_type`. | Yes |
|
|
| datasource_type | string, <br>**Available values:** "local_file", "online_document", "online_drive", "website_crawl" | Type of the datasource. Determines which fields are expected in `datasource_info_list` items.<br>*Enum:* `"local_file"`, `"online_document"`, `"online_drive"`, `"website_crawl"` | Yes |
|
|
| inputs | object | Key-value pairs for pipeline input variables defined in the workflow. Pass `{}` if the pipeline has no input variables. | Yes |
|
|
| is_published | boolean | Whether to run the published or draft version of the pipeline. `true` runs the latest published version; `false` runs the current draft (useful for testing unpublished changes). | Yes |
|
|
| response_mode | string, <br>**Available values:** "blocking", "streaming" | Response mode for draft runs. Use `streaming` for SSE or `blocking` for JSON. Published runs are queued and always return batch metadata as JSON.<br>*Enum:* `"blocking"`, `"streaming"` | Yes |
|
|
| start_node_id | string | ID of the datasource node where the run starts. | Yes |
|
|
|
|
#### PipelineRunJsonResponse
|
|
|
|
JSON result for published runs and draft runs using `response_mode: blocking`.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| PipelineRunJsonResponse | [PublishedPipelineRunResponse](#publishedpipelinerunresponse)<br>[WorkflowBlockingResponse](#workflowblockingresponse) | JSON result for published runs and draft runs using `response_mode: blocking`. | |
|
|
|
|
#### PipelineUploadFileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | string | | No |
|
|
| created_by | string | | Yes |
|
|
| extension | string | | Yes |
|
|
| id | string | | Yes |
|
|
| mime_type | string | | No |
|
|
| name | string | | Yes |
|
|
| size | integer | | Yes |
|
|
|
|
#### PreProcessingRule
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | Whether this preprocessing rule is enabled. | Yes |
|
|
| id | string, <br>**Available values:** "remove_extra_spaces", "remove_stopwords", "remove_urls_emails" | Rule identifier.<br>*Enum:* `"remove_extra_spaces"`, `"remove_stopwords"`, `"remove_urls_emails"` | Yes |
|
|
|
|
#### ProcessRule
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| mode | [ProcessRuleMode](#processrulemode) | `automatic` uses built-in rules, `custom` allows manual configuration, `hierarchical` enables parent-child chunk structure (use with `doc_form: hierarchical_model`). | Yes |
|
|
| rules | [Rule](#rule) | Custom processing rules. | No |
|
|
|
|
#### ProcessRuleMode
|
|
|
|
Dataset Process Rule Mode
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ProcessRuleMode | string | Dataset Process Rule Mode | |
|
|
|
|
#### ProviderModelWithStatusEntity
|
|
|
|
Model class for model response.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| deprecated | boolean | | No |
|
|
| features | [ [ModelFeature](#modelfeature) ] | | No |
|
|
| fetch_from | [FetchFrom](#fetchfrom) | Where the model definition comes from. `predefined-model` for built-in models, `customizable-model` for user-configured models. | Yes |
|
|
| has_invalid_load_balancing_configs | boolean | | No |
|
|
| label | [I18nObject](#i18nobject) | Localized display name of the model. | Yes |
|
|
| load_balancing_enabled | boolean | | No |
|
|
| model | string | | Yes |
|
|
| model_properties | object | | Yes |
|
|
| model_type | [ModelType](#modeltype) | Type of the model, matching the `model_type` path parameter. | Yes |
|
|
| status | [ModelStatus](#modelstatus) | Model availability status. `active` when ready to use. | Yes |
|
|
|
|
#### ProviderWithModelsListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ProviderWithModelsResponse](#providerwithmodelsresponse) ] | | Yes |
|
|
|
|
#### ProviderWithModelsResponse
|
|
|
|
Model class for provider with models response.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon_small | [I18nObject](#i18nobject) | | No |
|
|
| icon_small_dark | [I18nObject](#i18nobject) | | No |
|
|
| label | [I18nObject](#i18nobject) | Localized display name of the provider. | Yes |
|
|
| models | [ [ProviderModelWithStatusEntity](#providermodelwithstatusentity) ] | | Yes |
|
|
| provider | string | | Yes |
|
|
| status | [CustomConfigurationStatus](#customconfigurationstatus) | Provider status. `active` when credentials are configured and valid. | Yes |
|
|
| tenant_id | string | | Yes |
|
|
|
|
#### PublishedPipelineRunResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| batch | string | | Yes |
|
|
| dataset | [PipelineDataset](#pipelinedataset) | | Yes |
|
|
| documents | [ [PipelineDocument](#pipelinedocument) ] | | Yes |
|
|
|
|
#### RerankingModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| reranking_model_name | string | Name of the reranking model. | No |
|
|
| reranking_provider_name | string | Provider name of the reranking model. | No |
|
|
|
|
#### ResultResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | | Yes |
|
|
|
|
#### RetrievalMethod
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| RetrievalMethod | string | | |
|
|
|
|
#### RetrievalModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| metadata_filtering_conditions | [MetadataFilteringCondition](#metadatafilteringcondition) | Restrict retrieval to chunks whose document metadata matches the given conditions. Conditions are evaluated server-side against document metadata fields. | No |
|
|
| reranking_enable | boolean | Whether reranking is enabled. | Yes |
|
|
| reranking_mode | string, <br>**Available values:** "reranking_model", "weighted_score" | Reranking mode. Required when `reranking_enable` is `true`. | No |
|
|
| reranking_model | [RerankingModel](#rerankingmodel) | Reranking model configuration. | No |
|
|
| score_threshold | number | Minimum similarity score for results. Only effective when score threshold filtering is enabled. | No |
|
|
| score_threshold_enabled | boolean | Whether score threshold filtering is enabled. | Yes |
|
|
| search_method | [RetrievalMethod](#retrievalmethod) | Search method used for retrieval. | Yes |
|
|
| top_k | integer | Maximum number of results to return. | Yes |
|
|
| weights | [WeightModel](#weightmodel) | Weight configuration for hybrid search. | No |
|
|
|
|
#### RetrieverResource
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | No |
|
|
| created_at | integer | | No |
|
|
| data_source_type | string | | No |
|
|
| dataset_id | string | | No |
|
|
| dataset_name | string | | No |
|
|
| document_id | string | | No |
|
|
| document_name | string | | No |
|
|
| hit_count | integer | | No |
|
|
| id | string (uuid) | | No |
|
|
| index_node_hash | string | | No |
|
|
| message_id | string (uuid) | | No |
|
|
| position | integer | | Yes |
|
|
| score | number | | No |
|
|
| segment_id | string | | No |
|
|
| segment_position | integer | | No |
|
|
| summary | string | | No |
|
|
| word_count | integer | | No |
|
|
|
|
#### Rule
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| parent_mode | string, <br>**Available values:** "full-doc", "paragraph" | Parent-child segmentation mode. | No |
|
|
| pre_processing_rules | [ [PreProcessingRule](#preprocessingrule) ] | Pre-processing rules to apply before segmentation. | No |
|
|
| segmentation | [Segmentation](#segmentation) | Parent chunk segmentation settings. | No |
|
|
| subchunk_segmentation | [Segmentation](#segmentation) | Child chunk segmentation settings. | No |
|
|
|
|
#### ScopedTaskStopPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| user | string | End-user identifier, defined by your app and unique within it. Send the same `user` value used for the original generation request. See [End User Identity](/api-reference/guides/end-user-identity). | Yes |
|
|
|
|
#### SegmentAttachmentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| extension | string | | Yes |
|
|
| id | string | | Yes |
|
|
| mime_type | string | | Yes |
|
|
| name | string | | Yes |
|
|
| size | integer | | Yes |
|
|
| source_url | string | | Yes |
|
|
|
|
#### SegmentCreateItemPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | Answer content for QA mode. | No |
|
|
| attachment_ids | [ string ] | Attachment file IDs. | No |
|
|
| content | string | Chunk text content. | Yes |
|
|
| keywords | [ string ] | Keywords for the chunk. | No |
|
|
|
|
#### SegmentCreateListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [SegmentResponse](#segmentresponse) ] | | Yes |
|
|
| doc_form | string | | Yes |
|
|
|
|
#### SegmentCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| segments | [ [SegmentCreateItemPayload](#segmentcreateitempayload) ] | Array of chunk objects to create. | Yes |
|
|
|
|
#### SegmentDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [SegmentResponse](#segmentresponse) | | Yes |
|
|
| doc_form | string | | Yes |
|
|
|
|
#### SegmentListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword | string | Search keyword. | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of items per page. Server caps at `100`. | No |
|
|
| page | integer, <br>**Default:** 1 | Page number to retrieve. | No |
|
|
| status | [ string ] | Filter chunks by indexing status, such as `completed`, `indexing`, or `error`. | No |
|
|
|
|
#### SegmentListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [SegmentResponse](#segmentresponse) ] | | Yes |
|
|
| doc_form | string | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### SegmentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| attachments | [ [SegmentAttachmentResponse](#segmentattachmentresponse) ] | | Yes |
|
|
| child_chunks | [ [ChildChunkResponse](#childchunkresponse) ] | | Yes |
|
|
| completed_at | integer | | Yes |
|
|
| content | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| disabled_at | integer | | Yes |
|
|
| disabled_by | string | | Yes |
|
|
| document_id | string | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
| error | string | | Yes |
|
|
| hit_count | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| index_node_hash | string | | Yes |
|
|
| index_node_id | string | | Yes |
|
|
| indexing_at | integer | | Yes |
|
|
| keywords | [ string ] | | Yes |
|
|
| position | integer | | Yes |
|
|
| sign_content | string | | Yes |
|
|
| status | string | | Yes |
|
|
| stopped_at | integer | | Yes |
|
|
| summary | string | | Yes |
|
|
| tokens | integer | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| updated_by | string | | Yes |
|
|
| word_count | integer | | Yes |
|
|
|
|
#### SegmentUpdateArgs
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | Updated answer content for QA mode. | No |
|
|
| attachment_ids | [ string ] | Attachment file IDs. | No |
|
|
| content | string | Updated chunk text content. | No |
|
|
| enabled | boolean | Whether the chunk is enabled. | No |
|
|
| keywords | [ string ] | Updated keywords for the chunk. | No |
|
|
| regenerate_child_chunks | boolean | Whether to regenerate child chunks after updating a parent chunk. | No |
|
|
| summary | string | Summary content for summary index. | No |
|
|
|
|
#### SegmentUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| segment | [SegmentUpdateArgs](#segmentupdateargs) | Chunk data to update. | Yes |
|
|
|
|
#### Segmentation
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| chunk_overlap | integer | Token overlap between chunks. | No |
|
|
| max_tokens | integer | Maximum token count per chunk. | Yes |
|
|
| separator | string, <br>**Default:**
|
|
| Custom separator for splitting text. | No |
|
|
|
|
#### SelectInputConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| option_source | [StringListSource](#stringlistsource) | Source of options for `select` inputs. Present only when `type` is `select`. | Yes |
|
|
| output_variable_name | string | | Yes |
|
|
| type | string | | No |
|
|
|
|
#### SimpleAccountResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### SimpleConversation
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| id | string (uuid) | | Yes |
|
|
| inputs | object | | Yes |
|
|
| introduction | string | | No |
|
|
| name | string | | Yes |
|
|
| status | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
|
|
#### SimpleEndUser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| is_anonymous | boolean | | Yes |
|
|
| session_id | string | | No |
|
|
| type | string | | Yes |
|
|
|
|
#### SimpleFeedback
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| rating | string | | No |
|
|
|
|
#### SimpleResultResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | Operation result. | Yes |
|
|
|
|
#### SimpleResultStringListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ string ] | | Yes |
|
|
| result | string | | Yes |
|
|
|
|
#### Site
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| chat_color_theme | string | | No |
|
|
| chat_color_theme_inverted | boolean | | Yes |
|
|
| copyright | string | | No |
|
|
| custom_disclaimer | string | | No |
|
|
| default_language | string | | Yes |
|
|
| description | string | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| icon_url | string | | Yes |
|
|
| input_placeholder | string | | No |
|
|
| privacy_policy | string | | No |
|
|
| show_workflow_steps | boolean | | Yes |
|
|
| title | string | | Yes |
|
|
| use_icon_as_answer_icon | boolean | | Yes |
|
|
|
|
#### StringListSource
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| selector | [ string ] | Variable reference path when `type` is `variable`. | No |
|
|
| type | [ValueSourceType](#valuesourcetype) | Origin of the options. `constant` means `value` lists the options literally; `variable` means `selector` points to an `array[string]` workflow variable that provides them. | Yes |
|
|
| value | [ string ] | Literal option list when `type` is `constant`. | No |
|
|
|
|
#### StringSource
|
|
|
|
Default configuration for form inputs.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| selector | [ string ] | | No |
|
|
| type | [ValueSourceType](#valuesourcetype) | | Yes |
|
|
| value | string | | No |
|
|
|
|
#### SystemParameters
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| audio_file_size_limit | integer | | Yes |
|
|
| file_size_limit | integer | | Yes |
|
|
| image_file_size_limit | integer | | Yes |
|
|
| video_file_size_limit | integer | | Yes |
|
|
| workflow_file_upload_limit | integer | | Yes |
|
|
|
|
#### TagBindingPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| tag_ids | [ string ] | Tag IDs to bind. | Yes |
|
|
| target_id | string | Knowledge base ID to bind the tags to. | Yes |
|
|
|
|
#### TagCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | Tag name. | Yes |
|
|
|
|
#### TagDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| tag_id | string | Tag ID to delete. | Yes |
|
|
|
|
#### TagUnbindingPayload
|
|
|
|
Accepts either the legacy tag_id payload or the normalized tag_ids payload.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TagUnbindingPayload | object<br>object | Accepts either the legacy tag_id payload or the normalized tag_ids payload. | |
|
|
|
|
#### TagUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | Tag name. | Yes |
|
|
| tag_id | string | Tag ID to update. | Yes |
|
|
|
|
#### TextToAudioPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| message_id | string | Message ID. Takes priority over `text` when both are provided. | No |
|
|
| streaming | boolean | Reserved for compatibility; TTS response streaming is determined by the provider output. | No |
|
|
| text | string | Speech content to convert. | No |
|
|
| voice | string | Voice to use for text-to-speech. Available voices depend on the TTS provider configured for this app. Omit to use the app's configured voice when available; that value is exposed by [Get App Parameters](/api-reference/applications/get-app-parameters) as `text_to_speech.voice`. | No |
|
|
|
|
#### TextToAudioPayloadWithUser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| message_id | string | Message ID. Takes priority over `text` when both are provided. | No |
|
|
| streaming | boolean | Reserved for compatibility; TTS response streaming is determined by the provider output. | No |
|
|
| text | string | Speech content to convert. | No |
|
|
| user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | No |
|
|
| voice | string | Voice to use for text-to-speech. Available voices depend on the TTS provider configured for this app. Omit to use the app's configured voice when available; that value is exposed by [Get App Parameters](/api-reference/applications/get-app-parameters) as `text_to_speech.voice`. | No |
|
|
|
|
#### ToolIcon
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| background | string | | Yes |
|
|
| content | string | | Yes |
|
|
|
|
#### UrlResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| url | string | | Yes |
|
|
|
|
#### UserActionConfig
|
|
|
|
User action configuration.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| button_style | [ButtonStyle](#buttonstyle) | | No |
|
|
| id | string | | Yes |
|
|
| title | string | | Yes |
|
|
|
|
#### ValueSourceType
|
|
|
|
ValueSourceType records whether the value comes from a static setting
|
|
in form definition, or a variable while the workflow is running.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ValueSourceType | string | ValueSourceType records whether the value comes from a static setting in form definition, or a variable while the workflow is running. | |
|
|
|
|
#### WeightKeywordSetting
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword_weight | number | Weight assigned to keyword search results. | Yes |
|
|
|
|
#### WeightModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword_setting | [WeightKeywordSetting](#weightkeywordsetting) | Keyword search weight settings. | No |
|
|
| vector_setting | [WeightVectorSetting](#weightvectorsetting) | Semantic search weight settings. | No |
|
|
| weight_type | string, <br>**Available values:** "customized", "keyword_first", "semantic_first" | Strategy for balancing semantic and keyword search weights. | No |
|
|
|
|
#### WeightVectorSetting
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding_model_name | string | Name of the embedding model used for vector search. | Yes |
|
|
| embedding_provider_name | string | Provider of the embedding model used for vector search. | Yes |
|
|
| vector_weight | number | Weight assigned to semantic vector search results. | Yes |
|
|
|
|
#### WorkflowAppLogPaginationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowAppLogPartialResponse](#workflowapplogpartialresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### WorkflowAppLogPartialResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by_account | [SimpleAccountResponse](#simpleaccountresponse) | | No |
|
|
| created_by_end_user | [SimpleEndUser](#simpleenduser) | | No |
|
|
| created_by_role | string | | No |
|
|
| created_from | string | | No |
|
|
| details | object<br>[ object ]<br>string<br>integer<br>number<br>boolean | | No |
|
|
| id | string (uuid) | | Yes |
|
|
| workflow_run | [WorkflowRunForLogResponse](#workflowrunforlogresponse) | | No |
|
|
|
|
#### WorkflowBlockingResponse
|
|
|
|
Blocking workflow response for a finished or paused execution.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| WorkflowBlockingResponse | [WorkflowFinishedBlockingResponse](#workflowfinishedblockingresponse)<br>[WorkflowPausedBlockingResponse](#workflowpausedblockingresponse) | Blocking workflow response for a finished or paused execution. | |
|
|
|
|
#### WorkflowEventsQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| continue_on_pause | boolean | Set to `true` to keep the stream open across multiple `workflow_paused` events, which is useful when the workflow has more than one Human Input node in sequence. By default, the stream closes after the first pause. | No |
|
|
| include_state_snapshot | boolean | When `true`, replay from the persisted state snapshot to include a status summary of already-executed nodes before streaming new events. | No |
|
|
| user | string | End-user identifier that originally triggered the run. Must match the creator of the run. | Yes |
|
|
|
|
#### WorkflowFinishedBlockingDataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | long | | Yes |
|
|
| elapsed_time | float | | Yes |
|
|
| error | string | | Yes |
|
|
| finished_at | integer | | Yes |
|
|
| id | string (uuid) | | Yes |
|
|
| outputs | object | | Yes |
|
|
| status | string, <br>**Available values:** "failed", "partial-succeeded", "stopped", "succeeded" | *Enum:* `"failed"`, `"partial-succeeded"`, `"stopped"`, `"succeeded"` | Yes |
|
|
| total_steps | integer | | Yes |
|
|
| total_tokens | integer | | Yes |
|
|
| workflow_id | string (uuid) | | Yes |
|
|
|
|
#### WorkflowFinishedBlockingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [WorkflowFinishedBlockingDataResponse](#workflowfinishedblockingdataresponse) | | Yes |
|
|
| task_id | string | | Yes |
|
|
| workflow_run_id | string | | Yes |
|
|
|
|
#### WorkflowLogQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at__after | string | Filter logs created after this ISO 8601 timestamp. | No |
|
|
| created_at__before | string | Filter logs created before this ISO 8601 timestamp. | No |
|
|
| created_by_account | string | Filter by account ID. | No |
|
|
| created_by_end_user_session_id | string | Filter by end user session ID. | No |
|
|
| keyword | string | Keyword to search in logs. | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of items per page. | No |
|
|
| page | integer, <br>**Default:** 1 | Page number for pagination. | No |
|
|
| status | string, <br>**Available values:** "failed", "stopped", "succeeded" | Filter by execution status. | No |
|
|
|
|
#### WorkflowPauseReasonResponse
|
|
|
|
Public pause reason emitted by a blocking Workflow execution.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TYPE | string | | Yes |
|
|
| actions | [ [JSONObject](#jsonobject) ] | | No |
|
|
| approval_channels | [ string ] | | No |
|
|
| display_in_ui | boolean | | No |
|
|
| expiration_time | integer | | No |
|
|
| form_content | string | | No |
|
|
| form_id | string | | No |
|
|
| form_token | string | | No |
|
|
| inputs | [ [JSONObject](#jsonobject) ] | | No |
|
|
| message | string | | No |
|
|
| node_id | string | | No |
|
|
| node_title | string | | No |
|
|
| resolved_default_values | object | | No |
|
|
|
|
#### WorkflowPausedBlockingDataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | long | | Yes |
|
|
| elapsed_time | float | | Yes |
|
|
| error | string | | Yes |
|
|
| finished_at | integer | | Yes |
|
|
| id | string (uuid) | | Yes |
|
|
| outputs | object | | Yes |
|
|
| paused_nodes | [ string ] | | Yes |
|
|
| reasons | [ [WorkflowPauseReasonResponse](#workflowpausereasonresponse) ] | | Yes |
|
|
| status | string | | Yes |
|
|
| total_steps | integer | | Yes |
|
|
| total_tokens | integer | | Yes |
|
|
| workflow_id | string (uuid) | | Yes |
|
|
|
|
#### WorkflowPausedBlockingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [WorkflowPausedBlockingDataResponse](#workflowpausedblockingdataresponse) | | Yes |
|
|
| task_id | string | | Yes |
|
|
| workflow_run_id | string | | Yes |
|
|
|
|
#### WorkflowRunForLogResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| elapsed_time | number<br>integer | | No |
|
|
| error | string | | No |
|
|
| exceptions_count | integer | | No |
|
|
| finished_at | integer | | No |
|
|
| id | string (uuid) | | Yes |
|
|
| status | string | | No |
|
|
| total_steps | integer | | No |
|
|
| total_tokens | integer | | No |
|
|
| triggered_from | string | | No |
|
|
| version | string | | No |
|
|
|
|
#### WorkflowRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object<br>object<br>object<br>object ] | File list for workflow system file inputs. Available when file upload is enabled for the workflow. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No |
|
|
| inputs | object | Key-value pairs for workflow input variables. Values for file-type variables should be arrays of file objects with `type`, `transfer_method`, and either `url` or `upload_file_id`. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover the variable names and types expected by your app. | Yes |
|
|
| response_mode | string, <br>**Available values:** "blocking", "streaming" | Response mode. Use `blocking` for synchronous responses or `streaming` for Server-Sent Events. When omitted, the request runs in blocking mode. | No |
|
|
|
|
#### WorkflowRunPayloadWithUser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object<br>object<br>object<br>object ] | File list for workflow system file inputs. Available when file upload is enabled for the workflow. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No |
|
|
| inputs | object | Key-value pairs for workflow input variables. Values for file-type variables should be arrays of file objects with `type`, `transfer_method`, and either `url` or `upload_file_id`. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover the variable names and types expected by your app. | Yes |
|
|
| response_mode | string, <br>**Available values:** "blocking", "streaming" | Response mode. Use `blocking` for synchronous responses or `streaming` for Server-Sent Events. When omitted, the request runs in blocking mode. | No |
|
|
| user | string | User identifier, unique within the application. This identifier scopes data access; resources created with one `user` value are only visible when queried with the same `user` value. | Yes |
|
|
|
|
#### WorkflowRunResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| elapsed_time | number<br>integer | | No |
|
|
| error | string | | No |
|
|
| finished_at | integer | | No |
|
|
| id | string (uuid) | | Yes |
|
|
| inputs | object<br>[ object ]<br>string<br>integer<br>number<br>boolean | | No |
|
|
| outputs | object | | No |
|
|
| status | string | | Yes |
|
|
| total_steps | integer | | No |
|
|
| total_tokens | integer | | No |
|
|
| workflow_id | string (uuid) | | Yes |
|
|
|
|
#### WorkflowTaskStopPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| user | string | End-user identifier, defined by your app and unique within it. It does not need to match the `user` that started the run; the stop applies to the task regardless of `user`. See [End User Identity](/api-reference/guides/end-user-identity). | Yes |
|